Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153730 2914 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017153730 VERSION XM_017153730.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153730.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2914 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2914 /gene="rst" /note="roughest; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:108065652" CDS 489..2813 /gene="rst" /codon_start=1 /product="irregular chiasm C-roughest protein" /protein_id="XP_017009219.2" /db_xref="GeneID:108065652" /translation="MLQTMQLLLLATLVGMGMVGSSPYTSYQNQRFAMEPQDQTAVVG ARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLD DDARYQCQVSPGPEAQPAIRSTFAGLTVLVPPEAPKITQGDVIFATEDRKVEIECVSV GGKPAAEITWIDGLGTVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFTCQA QNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGASLGGASGGSHLGTGYRIVEHS QVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGK SEDSETLDISYAPSFRQRPQSMEADVGSVVSLSCEVDSNPQPEIVWIQHPSDRVVGTS TNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIE CFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYN CTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLP PADVISEHQITKNGGVSCKLEAGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLT TCSTKSNGSSTILQNNHQNQLQLQQQQQQQQGHQHHHQHHQPTTTLPMTFLTSSGGGS LTGSIIGSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTANGASATTTTTHVVVPA SSMALSVDPRYSAIYGNPYLRSSNSSLLPPPTAV" misc_feature 579..824 /gene="rst" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 627..641 /gene="rst" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409552" misc_feature 762..776 /gene="rst" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409552" misc_feature 804..821 /gene="rst" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409552" misc_feature 897..1169 /gene="rst" /note="CD80-like C2-set immunoglobulin domain; Region: C2-set_2; pfam08205" /db_xref="CDD:400489" misc_feature 945..959 /gene="rst" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409416" misc_feature 987..1001 /gene="rst" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409416" misc_feature 1083..1097 /gene="rst" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409416" misc_feature 1125..1142 /gene="rst" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409416" misc_feature 1170..1181 /gene="rst" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409416" misc_feature 1302..1511 /gene="rst" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1527..1724 /gene="rst" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 1773..2063 /gene="rst" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1827..1841 /gene="rst" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1869..1883 /gene="rst" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1962..1976 /gene="rst" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2004..2021 /gene="rst" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2043..2054 /gene="rst" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" ORIGIN 1 tcgtaccgtt cgcttcgcag cggcggaaat accaagtatc ttgcagatac agatacttct 61 cgagacccga agacgagaat ctcaatacaa aacccaaaca aatcgaaaca tattcaaata 121 caattatttt ttttttggtg caaacgcaag ccaaaaaata cattttggtg tggattacca 181 gtggaaaagt gagtgctaaa aatggattaa ataaaaataa aaaaaaaaca gcccaaacaa 241 aaccaaacaa gctgaaaatt ataactcaac gattatggat tagtgcctgt gattgttcag 301 aatcggttga aaaatataaa tatacacagt ttatagaact aaggagcccg agataaatat 361 aatatataaa tataaatatc tcaaggcccc aagacaaaca aactgaaagg cggagagaga 421 ggaaaaggaa aagtgagaaa gtgacacttg agacttgtgt tctcccatta aaaaggtgtt 481 gaagcaccat gttgcagacg atgcagctgc tcctgctggc caccttggtg gggatgggga 541 tggtcgggag ctcgccgtat acgagctacc agaaccagcg gttcgccatg gagccgcagg 601 accagacggc ggtggtcggg gccagggtca cattgccctg ccgggtgatc aacaaacagg 661 gaacgctgca gtggaccaag gacgacttcg gactgggcac atcccgggat ctcagcggat 721 tcgagcggta cgcgatggtg ggcagcgacg aggagggcga ctactcgctg gacatttacc 781 ccgtgatgct cgatgacgat gcgcgttatc agtgccaagt gagtccgggt cccgaggccc 841 agccggccat caggtccacc ttcgccggac tgacggtgct cgtgccgccc gaggcgccca 901 aaatcacgca gggcgacgtc atctttgcca ccgaggaccg caaggtggag atcgagtgcg 961 tttcggttgg cggaaagccg gctgcagaga ttacctggat tgatggcctc ggcaccgtgc 1021 taacggataa cattgagtac acggtgatac cgctgcccga tcagcggcgc tttacggcca 1081 agtccgtcct gcggctgacc cccaaaaagg agcaccacaa cacgaacttc acctgccagg 1141 cgcagaatac ggcggaccgc acctatcgct cggcgaaaat acgtgtcgag gttaaatacg 1201 cgcccaaggt gaaggtgaac gtgatgggtt cgctgcccgg tggagcagga gcgtccctcg 1261 gaggcgcaag cggcggttcg catttgggca ccggttaccg gattgtggag cactcgcagg 1321 tgcgactgga gtgccgggca gatgcgaatc ccagcgatgt ccggtaccgc tggttcataa 1381 acgacgagcc gatcatcggc ggccagaaga cagagatggt gattcgcaat gtgacgcgca 1441 agttccacga cgcgattgtc aagtgcgagg tgcagaattc cgtgggcaaa agtgaggaca 1501 gcgagaccct tgatataagc tatgctccca gcttccggca gcgacctcag tcgatggagg 1561 cagacgtagg cagtgtggtg tccctcagct gcgaggtgga cagcaatccg cagccggaga 1621 tcgtgtggat ccagcatccc agcgaccggg tggtcggcac cagcaccaat ctcacattca 1681 gtgtgagcaa cgagacggcc ggtcggtact actgcaaggc taatgttccc ggctacgccg 1741 agatatcggc ggatgcctat gtctacctaa agggatcccc agccatcggc tcccagagga 1801 cgcagtacgg attggtgggc gacacggcca ggatcgagtg ctttgcgagc agtgtacccc 1861 gtgcccgcca cgtctcgtgg accttcaatg gccaggaaat cagctcggaa tcgggacacg 1921 actactccat cctggtggac gcagttcccg gtggcgttaa gagcaccctg atcatccggg 1981 acagccaggc ctatcactat ggaaagtaca actgcacggt ggtcaacgat tatggcaacg 2041 atgtggcgga gattcagttg caggcaaaga agagcgtctc cctgctgatg acgattgtgg 2101 gcggcatctc ggtggtggcc ttcctgctgg tgctcaccat cctggtggtg gtctacatca 2161 agtgcaagaa gcgcaccaag ctgccgccgg cggacgtgat aagcgagcac cagatcacga 2221 agaacggcgg cgtgagctgc aagctggagg cgggcgaccg gacctcgaac tacagcgact 2281 tgaaggtgga catctcgggc ggctacgtgc cctacggcga ctacagcacc cactacagtc 2341 cgccgccgca gtatctgacc acctgctcta cgaagtcgaa cggcagctcg accatcctgc 2401 agaacaacca ccagaaccag ctgcagttgc agcagcagca gcagcagcag cagggccacc 2461 agcaccacca ccagcaccac cagccgacga cgaccctgcc gatgaccttc ctgaccagca 2521 gcggcggcgg cagcctgacg ggcagcatca tcggctcgcg ggagatccgc caggacaacg 2581 ggctgcccag cctgcagtcg accaccgcct cggtggtgag ctcctcgccg aacggcagct 2641 gcagcaacca gagcaccgcc aacggggcct ccgccaccac caccaccacc cacgtggtgg 2701 tgcccgccag ctcgatggcc ttgagcgtgg atccccgcta cagcgccatc tacggcaatc 2761 cctacctgcg ctcctccaac tcctcgctgc tgccgccgcc caccgccgtt tagggtggac 2821 cagcgaggcc accagcagca ctgccaacaa cgacgacgac gacccactga gccacgccaa 2881 gactgatctc acaaggaacc ggggccgctt tagg