Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii roughest (rst), mRNA.


LOCUS       XM_017153730            2914 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017153730
VERSION     XM_017153730.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153730.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2914
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2914
                     /gene="rst"
                     /note="roughest; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 13 Proteins"
                     /db_xref="GeneID:108065652"
     CDS             489..2813
                     /gene="rst"
                     /codon_start=1
                     /product="irregular chiasm C-roughest protein"
                     /protein_id="XP_017009219.2"
                     /db_xref="GeneID:108065652"
                     /translation="MLQTMQLLLLATLVGMGMVGSSPYTSYQNQRFAMEPQDQTAVVG
                     ARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLD
                     DDARYQCQVSPGPEAQPAIRSTFAGLTVLVPPEAPKITQGDVIFATEDRKVEIECVSV
                     GGKPAAEITWIDGLGTVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFTCQA
                     QNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGASLGGASGGSHLGTGYRIVEHS
                     QVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGK
                     SEDSETLDISYAPSFRQRPQSMEADVGSVVSLSCEVDSNPQPEIVWIQHPSDRVVGTS
                     TNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIE
                     CFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYN
                     CTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLP
                     PADVISEHQITKNGGVSCKLEAGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLT
                     TCSTKSNGSSTILQNNHQNQLQLQQQQQQQQGHQHHHQHHQPTTTLPMTFLTSSGGGS
                     LTGSIIGSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTANGASATTTTTHVVVPA
                     SSMALSVDPRYSAIYGNPYLRSSNSSLLPPPTAV"
     misc_feature    579..824
                     /gene="rst"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    627..641
                     /gene="rst"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409552"
     misc_feature    762..776
                     /gene="rst"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409552"
     misc_feature    804..821
                     /gene="rst"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409552"
     misc_feature    897..1169
                     /gene="rst"
                     /note="CD80-like C2-set immunoglobulin domain; Region:
                     C2-set_2; pfam08205"
                     /db_xref="CDD:400489"
     misc_feature    945..959
                     /gene="rst"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409416"
     misc_feature    987..1001
                     /gene="rst"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409416"
     misc_feature    1083..1097
                     /gene="rst"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409416"
     misc_feature    1125..1142
                     /gene="rst"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409416"
     misc_feature    1170..1181
                     /gene="rst"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409416"
     misc_feature    1302..1511
                     /gene="rst"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1527..1724
                     /gene="rst"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    1773..2063
                     /gene="rst"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1827..1841
                     /gene="rst"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1869..1883
                     /gene="rst"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1962..1976
                     /gene="rst"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2004..2021
                     /gene="rst"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2043..2054
                     /gene="rst"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
ORIGIN      
        1 tcgtaccgtt cgcttcgcag cggcggaaat accaagtatc ttgcagatac agatacttct
       61 cgagacccga agacgagaat ctcaatacaa aacccaaaca aatcgaaaca tattcaaata
      121 caattatttt ttttttggtg caaacgcaag ccaaaaaata cattttggtg tggattacca
      181 gtggaaaagt gagtgctaaa aatggattaa ataaaaataa aaaaaaaaca gcccaaacaa
      241 aaccaaacaa gctgaaaatt ataactcaac gattatggat tagtgcctgt gattgttcag
      301 aatcggttga aaaatataaa tatacacagt ttatagaact aaggagcccg agataaatat
      361 aatatataaa tataaatatc tcaaggcccc aagacaaaca aactgaaagg cggagagaga
      421 ggaaaaggaa aagtgagaaa gtgacacttg agacttgtgt tctcccatta aaaaggtgtt
      481 gaagcaccat gttgcagacg atgcagctgc tcctgctggc caccttggtg gggatgggga
      541 tggtcgggag ctcgccgtat acgagctacc agaaccagcg gttcgccatg gagccgcagg
      601 accagacggc ggtggtcggg gccagggtca cattgccctg ccgggtgatc aacaaacagg
      661 gaacgctgca gtggaccaag gacgacttcg gactgggcac atcccgggat ctcagcggat
      721 tcgagcggta cgcgatggtg ggcagcgacg aggagggcga ctactcgctg gacatttacc
      781 ccgtgatgct cgatgacgat gcgcgttatc agtgccaagt gagtccgggt cccgaggccc
      841 agccggccat caggtccacc ttcgccggac tgacggtgct cgtgccgccc gaggcgccca
      901 aaatcacgca gggcgacgtc atctttgcca ccgaggaccg caaggtggag atcgagtgcg
      961 tttcggttgg cggaaagccg gctgcagaga ttacctggat tgatggcctc ggcaccgtgc
     1021 taacggataa cattgagtac acggtgatac cgctgcccga tcagcggcgc tttacggcca
     1081 agtccgtcct gcggctgacc cccaaaaagg agcaccacaa cacgaacttc acctgccagg
     1141 cgcagaatac ggcggaccgc acctatcgct cggcgaaaat acgtgtcgag gttaaatacg
     1201 cgcccaaggt gaaggtgaac gtgatgggtt cgctgcccgg tggagcagga gcgtccctcg
     1261 gaggcgcaag cggcggttcg catttgggca ccggttaccg gattgtggag cactcgcagg
     1321 tgcgactgga gtgccgggca gatgcgaatc ccagcgatgt ccggtaccgc tggttcataa
     1381 acgacgagcc gatcatcggc ggccagaaga cagagatggt gattcgcaat gtgacgcgca
     1441 agttccacga cgcgattgtc aagtgcgagg tgcagaattc cgtgggcaaa agtgaggaca
     1501 gcgagaccct tgatataagc tatgctccca gcttccggca gcgacctcag tcgatggagg
     1561 cagacgtagg cagtgtggtg tccctcagct gcgaggtgga cagcaatccg cagccggaga
     1621 tcgtgtggat ccagcatccc agcgaccggg tggtcggcac cagcaccaat ctcacattca
     1681 gtgtgagcaa cgagacggcc ggtcggtact actgcaaggc taatgttccc ggctacgccg
     1741 agatatcggc ggatgcctat gtctacctaa agggatcccc agccatcggc tcccagagga
     1801 cgcagtacgg attggtgggc gacacggcca ggatcgagtg ctttgcgagc agtgtacccc
     1861 gtgcccgcca cgtctcgtgg accttcaatg gccaggaaat cagctcggaa tcgggacacg
     1921 actactccat cctggtggac gcagttcccg gtggcgttaa gagcaccctg atcatccggg
     1981 acagccaggc ctatcactat ggaaagtaca actgcacggt ggtcaacgat tatggcaacg
     2041 atgtggcgga gattcagttg caggcaaaga agagcgtctc cctgctgatg acgattgtgg
     2101 gcggcatctc ggtggtggcc ttcctgctgg tgctcaccat cctggtggtg gtctacatca
     2161 agtgcaagaa gcgcaccaag ctgccgccgg cggacgtgat aagcgagcac cagatcacga
     2221 agaacggcgg cgtgagctgc aagctggagg cgggcgaccg gacctcgaac tacagcgact
     2281 tgaaggtgga catctcgggc ggctacgtgc cctacggcga ctacagcacc cactacagtc
     2341 cgccgccgca gtatctgacc acctgctcta cgaagtcgaa cggcagctcg accatcctgc
     2401 agaacaacca ccagaaccag ctgcagttgc agcagcagca gcagcagcag cagggccacc
     2461 agcaccacca ccagcaccac cagccgacga cgaccctgcc gatgaccttc ctgaccagca
     2521 gcggcggcgg cagcctgacg ggcagcatca tcggctcgcg ggagatccgc caggacaacg
     2581 ggctgcccag cctgcagtcg accaccgcct cggtggtgag ctcctcgccg aacggcagct
     2641 gcagcaacca gagcaccgcc aacggggcct ccgccaccac caccaccacc cacgtggtgg
     2701 tgcccgccag ctcgatggcc ttgagcgtgg atccccgcta cagcgccatc tacggcaatc
     2761 cctacctgcg ctcctccaac tcctcgctgc tgccgccgcc caccgccgtt tagggtggac
     2821 cagcgaggcc accagcagca ctgccaacaa cgacgacgac gacccactga gccacgccaa
     2881 gactgatctc acaaggaacc ggggccgctt tagg