Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017153714             377 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065641), transcript variant X1, mRNA.
ACCESSION   XM_017153714
VERSION     XM_017153714.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153714.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..377
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..377
                     /gene="LOC108065641"
                     /note="uncharacterized LOC108065641; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108065641"
     CDS             1..345
                     /gene="LOC108065641"
                     /codon_start=1
                     /product="uncharacterized protein isoform X1"
                     /protein_id="XP_017009203.2"
                     /db_xref="GeneID:108065641"
                     /translation="MRWQLTILWLFVLVSSAPVIRLRRQIVTPKHFMEPLWPPILQEK
                     VIITPQKLREVADLRAKIQKAVDEDTYVVAASPSQDFLASLGGNWPAPLSLRQPWIAP
                     GFNFTFLWPRFG"
     misc_feature    <7..>285
                     /gene="LOC108065641"
                     /note="kdo(2)-lipid A phosphoethanolamine 7''-transferase;
                     Region: PRK11560"
                     /db_xref="CDD:183198"
ORIGIN      
        1 atgaggtggc agttgacgat cttgtggctc ttcgttttgg tgtcttccgc acctgtgata
       61 aggttgcgcc gtcaaatagt gacccctaag cacttcatgg aacccctttg gccgcccatc
      121 ttacaggaaa aggtaataat aaccccccag aagctgagag aggtggctga cctgagggcc
      181 aagattcaaa aggccgtcga tgaagacaca tacgtggtgg ccgcttcgcc ttcccaggat
      241 tttctagcca gccttggtgg aaattggcca gcgcctttat ccctgcgcca gccctggatt
      301 gcgccaggat ttaactttac tttcctttgg cccagatttg gctgacaact tggatacatt
      361 ttgcagctcg aaataaa