PREDICTED: Drosophila takahashii accessory gland protein

LOCUS       XM_017153648             699 bp    mRNA    linear   INV 09-DEC-2024
            Acp29AB-like (LOC108065614), mRNA.
ACCESSION   XM_017153648
VERSION     XM_017153648.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153648.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..699
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..699
                     /gene="LOC108065614"
                     /note="accessory gland protein Acp29AB-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 25 Proteins"
                     /db_xref="GeneID:108065614"
     CDS             1..699
                     /gene="LOC108065614"
                     /codon_start=1
                     /product="accessory gland protein Acp29AB-like"
                     /protein_id="XP_017009137.2"
                     /db_xref="GeneID:108065614"
                     /translation="MLKLAYFSVLLLIILVSQGSVAVQPMLEISMQTKLDAQLLAVQK
                     KLQDQNSANFLYFEARQQATEAKIEAQLKELQTQTKNQLLLLENQQSAFQKTLLETLS
                     TINNNIFDPRFKRIGSRYFYIEYNIRKSWEEAAETCHQMGGYLAAFKTQEELAAIMPK
                     LKTWFWYWTGIRHLKEDGRLISTASGKTATAFKWREGEPRNDGPCVLLNNIEMIDYRC
                     TSKQYFICQSDNET"
     misc_feature    358..681
                     /gene="LOC108065614"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(619..621,625..627,634..636,640..651,658..666)
                     /gene="LOC108065614"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgaagc tggcatattt ttccgtgctg ctgctcatta tcctggtgtc tcaaggatct
       61 gtggcggttc agcctatgtt ggagatttct atgcaaacca agttggatgc ccaacttctg
      121 gcggttcaga aaaagctgca ggatcaaaac tcagctaatt ttctatattt tgaggcaaga
      181 caacaagcaa cggaggctaa aattgaagcc caacttaagg agcttcaaac gcaaactaag
      241 aaccaacttc tgttgctgga gaaccaacag tcggcctttc agaaaaccct tctcgaaact
      301 ctttccacaa ttaacaacaa tatcttcgat cccagattta aacggatagg ctccagatat
      361 ttctatatcg aatataatat tcggaaatcc tgggaggagg ctgccgaaac atgtcatcaa
      421 atgggcggct atctggctgc ttttaaaacc caagaggaac tcgcagccat aatgccgaaa
      481 cttaagactt ggttctggta ctggactggc atcaggcatt tgaaggagga tggcaggctc
      541 atatctacgg cctccgggaa gacagccacc gcttttaaat ggcgggaggg agagcccaga
      601 aatgacggtc cctgcgttct actaaataac attgagatga ttgattaccg ttgcacttct
      661 aaacaatact ttatttgcca atctgataat gaaacataa