Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii kin of irre (kirre), mRNA.


LOCUS       XM_017153647            5694 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017153647
VERSION     XM_017153647.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153647.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5694
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..5694
                     /gene="kirre"
                     /note="kin of irre; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 21 Proteins"
                     /db_xref="GeneID:108065613"
     CDS             751..3627
                     /gene="kirre"
                     /codon_start=1
                     /product="irregular chiasm C-roughest protein"
                     /protein_id="XP_017009136.2"
                     /db_xref="GeneID:108065613"
                     /translation="MARMRSSRLLVPLPLILLLILTTLLLLQPTAVQAKSKKNKSNQN
                     SHHSDSSSSASQGSSSSAGSSSSSSDENKPKAGDNGGQHFAMEPQDQTAVVGSRVTLP
                     CRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQ
                     CQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA
                     EITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR
                     TYRSAKLLLEVKYAPKVSVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND
                     ELMTGDFTTKMIIHNVSRQYHEATVKCEVVNAVGKSEKNVQLDISFGPVFRQRPVSVE
                     ADLGATVSMRCEVAGNPTPEIEWISENNDRVVGNAPELKLKVSSENAGRYFCKAVVNG
                     FPEIGAEATVYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINM
                     SSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPG
                     NIPVLLVVMGSMFCVAIVLMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKS
                     ELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGG
                     DRYNRQCHIKNLKNQQETAYKGGSPQANGYAHYFEYALDYSPPGEGGAAVVVGGGAQG
                     QGGAKVKNGGMNSATLPHSGASVNGGGAGNGGGASLPRNQRHELQQSQQANGFLGQPL
                     LQNGIDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANG
                     GLKHFVGGAVITTSPVGNLNGMGGGGGGGGGSTPSGGGGVAAGGSVSGSSSNLTASSN
                     TLAATPLAGGGGNGGQCAQSPSGQFILSNNGKGHTQKGPLATHV"
     misc_feature    1012..1296
                     /gene="kirre"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1045..1059
                     /gene="kirre"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409552"
     misc_feature    1180..1194
                     /gene="kirre"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409552"
     misc_feature    1222..1239
                     /gene="kirre"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409552"
     misc_feature    1315..1587
                     /gene="kirre"
                     /note="CD80-like C2-set immunoglobulin domain; Region:
                     C2-set_2; pfam08205"
                     /db_xref="CDD:400489"
     misc_feature    1405..1419
                     /gene="kirre"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409416"
     misc_feature    1501..1515
                     /gene="kirre"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409416"
     misc_feature    1543..1560
                     /gene="kirre"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409416"
     misc_feature    1588..1599
                     /gene="kirre"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409416"
     misc_feature    1666..1878
                     /gene="kirre"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1687..1701
                     /gene="kirre"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409524"
     misc_feature    1729..1755
                     /gene="kirre"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409524"
     misc_feature    1780..1791
                     /gene="kirre"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409524"
     misc_feature    1822..1839
                     /gene="kirre"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409524"
     misc_feature    1894..2136
                     /gene="kirre"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1945..1959
                     /gene="kirre"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    1984..2001
                     /gene="kirre"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    2071..2088
                     /gene="kirre"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    2113..2124
                     /gene="kirre"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    2146..2433
                     /gene="kirre"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2194..2208
                     /gene="kirre"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2236..2250
                     /gene="kirre"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2335..2349
                     /gene="kirre"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2377..2394
                     /gene="kirre"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2416..2427
                     /gene="kirre"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     polyA_site      5694
                     /gene="kirre"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcagcagac agtcgagtta ttcggttgcc gcgaccctcg caacaacaac aaatcacaaa
       61 tacaacaaca ataaaggcaa cagcagcagc aacaacaaca caattttaaa taaaacaaca
      121 aaaaaccaac aacaacatca gtatcaaaaa taaccaacta aagtctaaac cgtaattttt
      181 tgaaagtgca atcagtgttt gttcctaaaa ttcacataga aaagaaaaac caagacgaaa
      241 aatctaaaaa aaaatcctta aatatgctac acaataattc cgaaaaaaat ctttaaaaaa
      301 tatcttaatt acaaaaaaat aaactacatt tttattttgt tattgtgtgt gcctctgtgt
      361 gtttctgtgt gtgctggcca acttcctgtg caaccggtct gcaaaacgaa aaaaaaaata
      421 aaaatccaac ccattcatac agcatccgac gcaagttgca cctgcaacat aaaaaaaaac
      481 aaatacaact aaaaaaaaag aaagaaaagc aatttataga agttgaagtt ggcgacataa
      541 acccgttttt tttcgggacg ggggaacaag gcagcgcctc caaggccaaa cacgatatcc
      601 acttggccac aacacaaaaa aaataagaga aaaaaacacc tcgcaggacc gcaaaaataa
      661 aagtaaagaa cgaaaataca gcagtgaacg acttgccaca tttttcctgg acattttcct
      721 ttatgctgag ttaacaattg cccggtgaaa atggcgagaa tgcgcagcag tcgcctcctg
      781 gtgcccctgc cactgattct cctgctgatc ctgacgacgc tgctcctcct ccagccgact
      841 gccgtccaag ccaagtcgaa gaagaacaag tccaaccaga actcgcacca cagtgactcc
      901 tcctcctccg cttcgcaggg atcctcctcc tcggcgggat cctcctcctc gtcgagtgac
      961 gagaacaaac cgaaggccgg cgacaatggt ggccagcact ttgccatgga gccgcaggat
     1021 cagaccgccg tcgtgggatc ccgggtcacg ttgccctgcc gggtgatgga gaaggtcggc
     1081 gccttgcagt ggaccaagga tgactttggc ctgggccagc atcggaatct cagcggcttc
     1141 gaacgctact cgatggtggg cagcgacgag gagggcgact tctcgctgga catctacccg
     1201 ctgatgctgg acgacgatgc caagtaccag tgccaagtgg gtccgggtcc gcagggcgag
     1261 cagggcattc gatcgcgctt cgccaagctg acggttctgg tgccgccgga ggcgccgaaa
     1321 atcacgcagg gtgattacct agtgaccacc gaggatcgcg agatcgagtt ggaatgcgtc
     1381 tcacagggcg gcaagccggc agcggaaatc acctggatcg atggcctggg caatgtccta
     1441 accaagggca ttgagtatgt caaggaaccg ctagccgatt cgcggcgcat aacggccaga
     1501 tcgattttga aattggcgcc caaaaaggag catcacaata cgaccttcac ctgccaggca
     1561 caaaataccg ccgatcgaac gtacagatcg gcgaagctcc tgctggaggt caagtatgcg
     1621 cccaaggtca gcgtttcggt ggtgggtggc gccttggcgg gcggtaaaat tcccgagggc
     1681 gccgaggtca ttctcagttg ccaggccgac gccaatccgc atgaactcag ctaccgttgg
     1741 ttcatcaacg atgagctaat gaccggtgat tttaccacca aaatgattat tcacaatgta
     1801 tcgcggcaat atcacgaggc cacggtcaaa tgcgaggtgg tcaatgcagt gggcaaaagc
     1861 gagaagaacg tccaactgga catcagtttt ggccccgttt tccgccagcg acccgttagt
     1921 gtggaggccg atctgggcgc cactgtgagc atgcgttgcg aggtcgccgg caatcccacg
     1981 cccgaaatcg aatggatcag cgagaacaat gatagggtgg ttggcaacgc accggaactg
     2041 aagctgaagg tgagcagcga gaacgctggc cgctacttct gcaaggcggt ggtcaacgga
     2101 ttccccgaga tcggggccga ggcgacggtc tacgtgaaga gggccccgat catcacgtcg
     2161 cacaaggtgc agtttggcgg cgtcggtggt cgcgtgaaga tcgactgcct ggccttcagc
     2221 atcccgaagg cggagcacat tctctggtcg ttcgagggca agatcatcaa tatgagcagt
     2281 gccgatccgg atatctatat cttcgaggag caccacctgc cggagggcgt gcgagcggcg
     2341 ctgataatca gggacagcaa ggccacccat ttcggcaagt acaattgcac agtgatgaat
     2401 tcgtacggcg gtgattcatt ggtgataacc ctgctgcgcg aacccggcaa tatacccgtt
     2461 ctgctggtgg tcatgggctc catgttctgc gtggccatcg tcctgatgat cgtgatgatc
     2521 atcattgtct atcgcaagcg tcgcagtcgc aagaagccca tgcccgctga cgtcatcccg
     2581 gaggcgtcac gtggcggtga caagctgaat gaactgaaga gcgagctgcg ctcgaaggcc
     2641 tacgatgtgg agtactcgga ggcgggcggc gatggtctgg ccatcaatct gacgcaatcc
     2701 cccatgcccg atgtccagat gaagggcgcc accctgggcg ttccgctcgc gggacccgtg
     2761 aagttcgacg agcgattctc gggcgacttc ggtggcgatc gctacaatcg gcagtgccac
     2821 atcaagaacc tgaagaatca gcaggagacc gcctacaagg gcggcagtcc gcaggccaat
     2881 ggctatgccc actacttcga gtatgccctg gactacagtc cgcccggcga gggcggtgcg
     2941 gccgtggtgg tgggcggcgg tgctcagggt cagggtggcg ccaaggtcaa gaacggtggc
     3001 atgaactcgg ctacgctgcc ccactcgggc gcctctgtca acgggggcgg cgccggcaat
     3061 gggggcgggg ccagtctgcc acgcaaccag cgacacgaac ttcagcagtc ccagcaggcg
     3121 aacggatttc tcggtcaacc gctacttcag aacggcatcg atagccgatt tagcgccatc
     3181 tacggtaatc cctacctaag gacgaactcc tcgctgctgc cgcccctccc accgcccagt
     3241 accgccaatc cggcggccac gcccgccccg ccgccctatc atgcagcccg ccacggccac
     3301 gcccaccatg ccaacggcgg cctgaagcac ttcgtgggcg gcgcggtgat cacgacgagt
     3361 ccagttggga atttgaatgg aatgggtggc ggtggaggcg gagggggtgg ctcaacgccc
     3421 agtggcggag ggggcgtggc agcgggcggc agcgtcagcg gtagcagttc gaatttaacc
     3481 gccagcagta acaccttggc tgccacgccc ctggcgggcg gtggcggaaa cggcggccag
     3541 tgtgcccaga gtccgtccgg ccaatttata ctgtccaaca atggcaaggg acacacgcag
     3601 aaaggacctc tggccacaca cgtttaagtg ggaaggcgaa cttttcgaaa atcctggaaa
     3661 acgaaggcaa agaaggatat atatataaat atgaagcatt agcataaccc gtaaatgtat
     3721 taaaaagcag aacttctagt gtgtaaccat cctttttttt tggtcgataa atattagcgt
     3781 aattctggct caagtggtgt caactattta cgattgggcc tcgcaaagta taacttctac
     3841 atataattat atcatggctg aaatttaagc actaagagcg atttttcctt tgcctttttg
     3901 taaatttgta tcgtacagac ccggaggcaa tagttcggca tccttgagca aaaaacctaa
     3961 ccatgaaaat atattgtatg taaagaaaaa aaaaacagaa aagaaaagaa aacaaaaacc
     4021 gtattgtgat ttatagcgtt aattatttta cggcaacggc aaattatatc aactagtgca
     4081 aatcttaagc tacttatcga gtaaaaaaat cgtatatcaa ttaaacacga aacgtatcgg
     4141 aaaagaaatg agaagggaaa agcataaaca taaacataaa ccaactacca aacttgaaaa
     4201 gttcatttta aacagcgagt tgcatacaat tttaaaaaac aaaaaccgaa aatcaattca
     4261 attaaataga aacgtaatta tgaaatgcct gtagttagtt tcaattaaat gaaagggaat
     4321 gaaagagatg aaatgcaaaa gcagcaagca aaaacaattt tctaagccaa aatttatcaa
     4381 atttttagac ttaaatataa atatataaat atgaagaaat acgaaaacaa aaaaatgagt
     4441 gcagtgagag aaacctttag agtaaatgct gtaattgtcg agtgacccgg tcaagaaaag
     4501 ccaaaagtga aagtcaatct tgataatttt tgcttattgt ttatattatt ttgagaaaaa
     4561 ttacattttt ttaaagaata tttttaggaa cattaatttt gttacgggac gctgcagtat
     4621 taacacaatt taaaaatccc caaaaattta aatagattaa taaaaagtcg ccactatagt
     4681 tcccaatttt taaacttgat cgggtctcaa ggagctcagc atcccagcat ccatgtgaaa
     4741 acttgaatac tttttttgcc tagcccttaa gcgagtaaat gaaatttaaa attaaatcaa
     4801 ttatgtaaag aaacaagtgg aatattgtat atcgtatata tatatatata tatatatata
     4861 gatcataaat gtgtatgtca acgcttaaat taaatgacta gctaagatta gagagaatgt
     4921 ttgttttttt tttgtctgcc tagtggttta agcctattta taaacgtaaa cgagaagtac
     4981 atgtaaacaa ttttaatggt aaagaaaaca aaacttaaaa agcttagcaa caatttgtaa
     5041 aacatttgag cgatctacca aaaaaaaaac aaaaaacgca actaagtgtg aagcgtaaaa
     5101 tttttaacac gaaatgctgc cttatgattc cttgttgggt tcttaattca ttaagccaat
     5161 actgtaatta attttttttt gtttattttc gtaaaacata tacacaaata tacatattta
     5221 tctagagtaa tactgaaaat gctttaaatg ttctttattt accctgattt attcactcga
     5281 atccatttca attctttcct tggcctattt gcgcagagct ttttaaatgg aatgcggttc
     5341 cgaaaatcgg aaacagagat ggtgttacat tttttggata attgtcaaac gattcaatta
     5401 aaagttcaat tacatagacg ttacaaaaaa atacaaaacg atacaaaaaa agaaaacaga
     5461 aaattcaaat gaaaatgaaa atcctattaa gccaagtaaa ttacgataat tgcaagaaac
     5521 gtgtatgtaa agtgcagagt gctgagaaaa tggttcggaa aatgaaaact aagaacgtat
     5581 tgcgtgctaa aggaagagaa aacgaaaaat taacttaagt cgagaacaac tcaaattagt
     5641 tgaaataaaa atgcaagaaa aaaccgaaat aaaatattta aaaatgctaa aaaa