Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153647 5694 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017153647 VERSION XM_017153647.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153647.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5694 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..5694 /gene="kirre" /note="kin of irre; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 Proteins" /db_xref="GeneID:108065613" CDS 751..3627 /gene="kirre" /codon_start=1 /product="irregular chiasm C-roughest protein" /protein_id="XP_017009136.2" /db_xref="GeneID:108065613" /translation="MARMRSSRLLVPLPLILLLILTTLLLLQPTAVQAKSKKNKSNQN SHHSDSSSSASQGSSSSAGSSSSSSDENKPKAGDNGGQHFAMEPQDQTAVVGSRVTLP CRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQ CQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA EITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR TYRSAKLLLEVKYAPKVSVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND ELMTGDFTTKMIIHNVSRQYHEATVKCEVVNAVGKSEKNVQLDISFGPVFRQRPVSVE ADLGATVSMRCEVAGNPTPEIEWISENNDRVVGNAPELKLKVSSENAGRYFCKAVVNG FPEIGAEATVYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINM SSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPG NIPVLLVVMGSMFCVAIVLMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKS ELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGG DRYNRQCHIKNLKNQQETAYKGGSPQANGYAHYFEYALDYSPPGEGGAAVVVGGGAQG QGGAKVKNGGMNSATLPHSGASVNGGGAGNGGGASLPRNQRHELQQSQQANGFLGQPL LQNGIDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANG GLKHFVGGAVITTSPVGNLNGMGGGGGGGGGSTPSGGGGVAAGGSVSGSSSNLTASSN TLAATPLAGGGGNGGQCAQSPSGQFILSNNGKGHTQKGPLATHV" misc_feature 1012..1296 /gene="kirre" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1045..1059 /gene="kirre" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409552" misc_feature 1180..1194 /gene="kirre" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409552" misc_feature 1222..1239 /gene="kirre" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409552" misc_feature 1315..1587 /gene="kirre" /note="CD80-like C2-set immunoglobulin domain; Region: C2-set_2; pfam08205" /db_xref="CDD:400489" misc_feature 1405..1419 /gene="kirre" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409416" misc_feature 1501..1515 /gene="kirre" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409416" misc_feature 1543..1560 /gene="kirre" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409416" misc_feature 1588..1599 /gene="kirre" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409416" misc_feature 1666..1878 /gene="kirre" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1687..1701 /gene="kirre" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409524" misc_feature 1729..1755 /gene="kirre" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409524" misc_feature 1780..1791 /gene="kirre" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409524" misc_feature 1822..1839 /gene="kirre" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409524" misc_feature 1894..2136 /gene="kirre" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1945..1959 /gene="kirre" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1984..2001 /gene="kirre" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 2071..2088 /gene="kirre" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 2113..2124 /gene="kirre" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 2146..2433 /gene="kirre" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2194..2208 /gene="kirre" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2236..2250 /gene="kirre" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2335..2349 /gene="kirre" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2377..2394 /gene="kirre" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2416..2427 /gene="kirre" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" polyA_site 5694 /gene="kirre" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcagcagac agtcgagtta ttcggttgcc gcgaccctcg caacaacaac aaatcacaaa 61 tacaacaaca ataaaggcaa cagcagcagc aacaacaaca caattttaaa taaaacaaca 121 aaaaaccaac aacaacatca gtatcaaaaa taaccaacta aagtctaaac cgtaattttt 181 tgaaagtgca atcagtgttt gttcctaaaa ttcacataga aaagaaaaac caagacgaaa 241 aatctaaaaa aaaatcctta aatatgctac acaataattc cgaaaaaaat ctttaaaaaa 301 tatcttaatt acaaaaaaat aaactacatt tttattttgt tattgtgtgt gcctctgtgt 361 gtttctgtgt gtgctggcca acttcctgtg caaccggtct gcaaaacgaa aaaaaaaata 421 aaaatccaac ccattcatac agcatccgac gcaagttgca cctgcaacat aaaaaaaaac 481 aaatacaact aaaaaaaaag aaagaaaagc aatttataga agttgaagtt ggcgacataa 541 acccgttttt tttcgggacg ggggaacaag gcagcgcctc caaggccaaa cacgatatcc 601 acttggccac aacacaaaaa aaataagaga aaaaaacacc tcgcaggacc gcaaaaataa 661 aagtaaagaa cgaaaataca gcagtgaacg acttgccaca tttttcctgg acattttcct 721 ttatgctgag ttaacaattg cccggtgaaa atggcgagaa tgcgcagcag tcgcctcctg 781 gtgcccctgc cactgattct cctgctgatc ctgacgacgc tgctcctcct ccagccgact 841 gccgtccaag ccaagtcgaa gaagaacaag tccaaccaga actcgcacca cagtgactcc 901 tcctcctccg cttcgcaggg atcctcctcc tcggcgggat cctcctcctc gtcgagtgac 961 gagaacaaac cgaaggccgg cgacaatggt ggccagcact ttgccatgga gccgcaggat 1021 cagaccgccg tcgtgggatc ccgggtcacg ttgccctgcc gggtgatgga gaaggtcggc 1081 gccttgcagt ggaccaagga tgactttggc ctgggccagc atcggaatct cagcggcttc 1141 gaacgctact cgatggtggg cagcgacgag gagggcgact tctcgctgga catctacccg 1201 ctgatgctgg acgacgatgc caagtaccag tgccaagtgg gtccgggtcc gcagggcgag 1261 cagggcattc gatcgcgctt cgccaagctg acggttctgg tgccgccgga ggcgccgaaa 1321 atcacgcagg gtgattacct agtgaccacc gaggatcgcg agatcgagtt ggaatgcgtc 1381 tcacagggcg gcaagccggc agcggaaatc acctggatcg atggcctggg caatgtccta 1441 accaagggca ttgagtatgt caaggaaccg ctagccgatt cgcggcgcat aacggccaga 1501 tcgattttga aattggcgcc caaaaaggag catcacaata cgaccttcac ctgccaggca 1561 caaaataccg ccgatcgaac gtacagatcg gcgaagctcc tgctggaggt caagtatgcg 1621 cccaaggtca gcgtttcggt ggtgggtggc gccttggcgg gcggtaaaat tcccgagggc 1681 gccgaggtca ttctcagttg ccaggccgac gccaatccgc atgaactcag ctaccgttgg 1741 ttcatcaacg atgagctaat gaccggtgat tttaccacca aaatgattat tcacaatgta 1801 tcgcggcaat atcacgaggc cacggtcaaa tgcgaggtgg tcaatgcagt gggcaaaagc 1861 gagaagaacg tccaactgga catcagtttt ggccccgttt tccgccagcg acccgttagt 1921 gtggaggccg atctgggcgc cactgtgagc atgcgttgcg aggtcgccgg caatcccacg 1981 cccgaaatcg aatggatcag cgagaacaat gatagggtgg ttggcaacgc accggaactg 2041 aagctgaagg tgagcagcga gaacgctggc cgctacttct gcaaggcggt ggtcaacgga 2101 ttccccgaga tcggggccga ggcgacggtc tacgtgaaga gggccccgat catcacgtcg 2161 cacaaggtgc agtttggcgg cgtcggtggt cgcgtgaaga tcgactgcct ggccttcagc 2221 atcccgaagg cggagcacat tctctggtcg ttcgagggca agatcatcaa tatgagcagt 2281 gccgatccgg atatctatat cttcgaggag caccacctgc cggagggcgt gcgagcggcg 2341 ctgataatca gggacagcaa ggccacccat ttcggcaagt acaattgcac agtgatgaat 2401 tcgtacggcg gtgattcatt ggtgataacc ctgctgcgcg aacccggcaa tatacccgtt 2461 ctgctggtgg tcatgggctc catgttctgc gtggccatcg tcctgatgat cgtgatgatc 2521 atcattgtct atcgcaagcg tcgcagtcgc aagaagccca tgcccgctga cgtcatcccg 2581 gaggcgtcac gtggcggtga caagctgaat gaactgaaga gcgagctgcg ctcgaaggcc 2641 tacgatgtgg agtactcgga ggcgggcggc gatggtctgg ccatcaatct gacgcaatcc 2701 cccatgcccg atgtccagat gaagggcgcc accctgggcg ttccgctcgc gggacccgtg 2761 aagttcgacg agcgattctc gggcgacttc ggtggcgatc gctacaatcg gcagtgccac 2821 atcaagaacc tgaagaatca gcaggagacc gcctacaagg gcggcagtcc gcaggccaat 2881 ggctatgccc actacttcga gtatgccctg gactacagtc cgcccggcga gggcggtgcg 2941 gccgtggtgg tgggcggcgg tgctcagggt cagggtggcg ccaaggtcaa gaacggtggc 3001 atgaactcgg ctacgctgcc ccactcgggc gcctctgtca acgggggcgg cgccggcaat 3061 gggggcgggg ccagtctgcc acgcaaccag cgacacgaac ttcagcagtc ccagcaggcg 3121 aacggatttc tcggtcaacc gctacttcag aacggcatcg atagccgatt tagcgccatc 3181 tacggtaatc cctacctaag gacgaactcc tcgctgctgc cgcccctccc accgcccagt 3241 accgccaatc cggcggccac gcccgccccg ccgccctatc atgcagcccg ccacggccac 3301 gcccaccatg ccaacggcgg cctgaagcac ttcgtgggcg gcgcggtgat cacgacgagt 3361 ccagttggga atttgaatgg aatgggtggc ggtggaggcg gagggggtgg ctcaacgccc 3421 agtggcggag ggggcgtggc agcgggcggc agcgtcagcg gtagcagttc gaatttaacc 3481 gccagcagta acaccttggc tgccacgccc ctggcgggcg gtggcggaaa cggcggccag 3541 tgtgcccaga gtccgtccgg ccaatttata ctgtccaaca atggcaaggg acacacgcag 3601 aaaggacctc tggccacaca cgtttaagtg ggaaggcgaa cttttcgaaa atcctggaaa 3661 acgaaggcaa agaaggatat atatataaat atgaagcatt agcataaccc gtaaatgtat 3721 taaaaagcag aacttctagt gtgtaaccat cctttttttt tggtcgataa atattagcgt 3781 aattctggct caagtggtgt caactattta cgattgggcc tcgcaaagta taacttctac 3841 atataattat atcatggctg aaatttaagc actaagagcg atttttcctt tgcctttttg 3901 taaatttgta tcgtacagac ccggaggcaa tagttcggca tccttgagca aaaaacctaa 3961 ccatgaaaat atattgtatg taaagaaaaa aaaaacagaa aagaaaagaa aacaaaaacc 4021 gtattgtgat ttatagcgtt aattatttta cggcaacggc aaattatatc aactagtgca 4081 aatcttaagc tacttatcga gtaaaaaaat cgtatatcaa ttaaacacga aacgtatcgg 4141 aaaagaaatg agaagggaaa agcataaaca taaacataaa ccaactacca aacttgaaaa 4201 gttcatttta aacagcgagt tgcatacaat tttaaaaaac aaaaaccgaa aatcaattca 4261 attaaataga aacgtaatta tgaaatgcct gtagttagtt tcaattaaat gaaagggaat 4321 gaaagagatg aaatgcaaaa gcagcaagca aaaacaattt tctaagccaa aatttatcaa 4381 atttttagac ttaaatataa atatataaat atgaagaaat acgaaaacaa aaaaatgagt 4441 gcagtgagag aaacctttag agtaaatgct gtaattgtcg agtgacccgg tcaagaaaag 4501 ccaaaagtga aagtcaatct tgataatttt tgcttattgt ttatattatt ttgagaaaaa 4561 ttacattttt ttaaagaata tttttaggaa cattaatttt gttacgggac gctgcagtat 4621 taacacaatt taaaaatccc caaaaattta aatagattaa taaaaagtcg ccactatagt 4681 tcccaatttt taaacttgat cgggtctcaa ggagctcagc atcccagcat ccatgtgaaa 4741 acttgaatac tttttttgcc tagcccttaa gcgagtaaat gaaatttaaa attaaatcaa 4801 ttatgtaaag aaacaagtgg aatattgtat atcgtatata tatatatata tatatatata 4861 gatcataaat gtgtatgtca acgcttaaat taaatgacta gctaagatta gagagaatgt 4921 ttgttttttt tttgtctgcc tagtggttta agcctattta taaacgtaaa cgagaagtac 4981 atgtaaacaa ttttaatggt aaagaaaaca aaacttaaaa agcttagcaa caatttgtaa 5041 aacatttgag cgatctacca aaaaaaaaac aaaaaacgca actaagtgtg aagcgtaaaa 5101 tttttaacac gaaatgctgc cttatgattc cttgttgggt tcttaattca ttaagccaat 5161 actgtaatta attttttttt gtttattttc gtaaaacata tacacaaata tacatattta 5221 tctagagtaa tactgaaaat gctttaaatg ttctttattt accctgattt attcactcga 5281 atccatttca attctttcct tggcctattt gcgcagagct ttttaaatgg aatgcggttc 5341 cgaaaatcgg aaacagagat ggtgttacat tttttggata attgtcaaac gattcaatta 5401 aaagttcaat tacatagacg ttacaaaaaa atacaaaacg atacaaaaaa agaaaacaga 5461 aaattcaaat gaaaatgaaa atcctattaa gccaagtaaa ttacgataat tgcaagaaac 5521 gtgtatgtaa agtgcagagt gctgagaaaa tggttcggaa aatgaaaact aagaacgtat 5581 tgcgtgctaa aggaagagaa aacgaaaaat taacttaagt cgagaacaac tcaaattagt 5641 tgaaataaaa atgcaagaaa aaaccgaaat aaaatattta aaaatgctaa aaaa