Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ionotropic receptor 20a (Ir20a),


LOCUS       XM_017153592            1689 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017153592
VERSION     XM_017153592.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153592.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1689
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1689
                     /gene="Ir20a"
                     /note="Ionotropic receptor 20a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065579"
     CDS             1..1689
                     /gene="Ir20a"
                     /codon_start=1
                     /product="uncharacterized protein Ir20a"
                     /protein_id="XP_017009081.2"
                     /db_xref="GeneID:108065579"
                     /translation="MLANLERSLAAELLDLYGLVAQFLLSTEATLVYYNPASLDCSWS
                     VLWRRHLTAHPQIVWQLSYPQPELYDRINGGGLLVLACLSEDSSSISQLENLATSLNH
                     LRTSVRLLIEVAAFDEESLASRLLSFCLRRSILQVELYFRNTNHSPWNLYSYHPFPNF
                     ELVKRNISSGNKVEIFENKLVDLRGHRLRVMPDLSPPNTFFYRDERDENQVAGYLWDF
                     MDTFAGRLNATLRMVRPKFRAGVAPESSYMLQYTAQGLIDVGLTTTLITRRNLWAMHQ
                     YTYPILISSWCTMLPVERPLKTPDLFNRILCPALAVILLLVILITWLAFGHLNCLLLL
                     RNSRMARIVPRLLALLLLTTSSSQLLSLLISPPYQERITSFEDLLRGDQRILGMRSEF
                     YDFDGAFRARYAGIFYLIDDPDELYDLRNHFNTTWGYTMAYIKWLVINTQQRHFAKPV
                     FRWAKDLCFIDFMPTSIVVAPDSIYWEALKDFSLAADRAGLLKHWVRKSFYDMVKAGK
                     MSIKDYSELVTLEPLNVADLQLVWRICGAAIAAATGIFLMELLFFYVNVFLNSL"
ORIGIN      
        1 atgttggcca acttggagcg gagccttgca gccgagctgc tggacctata cggcctggtg
       61 gcccagtttc ttctctccac cgaagccacc ttggtctact acaatcccgc ctccttggac
      121 tgcagctgga gtgtcctgtg gcggcgccac ctcaccgccc atccgcagat cgtctggcag
      181 ctcagctatc cccagccgga actctatgat cgcatcaacg gcggtggcct cctggttctg
      241 gcctgcttgt cagaggattc cagctccata agtcagctgg aaaacctagc caccagtcta
      301 aatcacctgc gaacctcggt gcgtttgctc atcgaagtgg cggccttcga tgaggaatcc
      361 ctggccagtc ggttgctctc cttttgcctg cgccggagca tcctgcaggt ggagctgtat
      421 ttccggaaca ccaatcactc cccctggaac ctctacagct atcacccatt tcccaacttt
      481 gagttggtca agagaaacat ctcaagtgga aataaggtgg aaatctttga aaataaactg
      541 gtggacctgc gaggacatcg gctgcgcgtt atgccggatc tatcgccacc gaataccttt
      601 ttctatcgcg atgagaggga tgagaaccaa gtggccggct atctgtggga ctttatggac
      661 acctttgcag gccgcttgaa tgccaccctg agaatggttc gtcccaaatt tcgggccggt
      721 gtcgcccccg agagctctta catgctgcag tacaccgctc agggtctcat agacgtcggc
      781 ctgacaacca ctttaattac gcgccgcaat ttgtgggcca tgcaccagta cacctatccg
      841 attttgatct ccagctggtg caccatgttg ccggtggagc gaccactgaa aacgcctgat
      901 cttttcaaca ggatcttgtg tcctgctttg gctgtgatcc tgctgctcgt catcctgatc
      961 acctggctgg ctttcggtca cctgaactgc ctgctgctct tgagaaactc gagaatggcc
     1021 aggattgtgc cgagattgct ggccctgctc ctgctgacca ccagcagttc gcagctgctg
     1081 tcgctgctga tctcaccgcc ttaccaggag aggatcacca gcttcgagga tctgctgagg
     1141 ggggaccaga ggatcctggg catgcgcagc gagttctacg actttgatgg ggccttcagg
     1201 gcccgatatg cgggcatttt ctacctgatc gacgatcccg acgagctgta cgatctgcgg
     1261 aatcacttca acaccacctg gggctacacc atggcctaca tcaagtggct ggtgataaac
     1321 acccagcagc gacacttcgc caagccggtt ttccgttggg cgaaggacct gtgcttcatc
     1381 gacttcatgc ccaccagcat tgtcgtggcc cccgattcga tttactggga ggcactgaag
     1441 gacttctcgc tcgccgccga tcgggcggga cttttaaagc actgggtgcg aaagagcttc
     1501 tacgatatgg tgaaggcggg aaagatgagc atcaaggact acagcgaact ggtgaccctg
     1561 gagcccctga atgtcgccga tctgcagctc gtgtggcgca tctgtggagc agccatcgcg
     1621 gcggccaccg gcattttcct catggagctg ctgttcttct atgtcaacgt ttttctcaac
     1681 agtttgtag