PREDICTED: Drosophila takahashii C-type lectin 37Db-like

LOCUS       XM_017153585             614 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065573), mRNA.
ACCESSION   XM_017153585
VERSION     XM_017153585.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153585.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 13% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..614
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..614
                     /gene="LOC108065573"
                     /note="C-type lectin 37Db-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108065573"
     CDS             18..614
                     /gene="LOC108065573"
                     /codon_start=1
                     /product="C-type lectin 37Db-like"
                     /protein_id="XP_017009074.2"
                     /db_xref="GeneID:108065573"
                     /translation="MLRLVVSLFVLNFFGPLSAVEGQLVAENSDMKNDLFVRMENVEK
                     FMQTKIDAQLQAIQKMLEDLNAGGRKQIIDPRFERIGCRYFYIEHNIEKNWDEAAETC
                     REMGGYLAAFENQEEIEAIMQKLKKEQYYWYWTGIKHLEEDGKFISTASGKTTNVFKW
                     YSGQPGNSGACVLLDFMGMRDFDCRLKSSFICQSDNET"
     misc_feature    267..596
                     /gene="LOC108065573"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(522..524,534..536,540..542,549..551,555..566,
                     573..581)
                     /gene="LOC108065573"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 agttgcagtg atcaaaaatg ctgagactcg tggtctcttt gttcgtcctt aacttctttg
       61 gaccgttgag cgccgtcgaa ggtcaacttg tggcggaaaa ctcagacatg aagaatgatt
      121 tgttcgtcag aatggaaaat gtggagaaat tcatgcaaac caaaatagat gcccaattgc
      181 aggcgataca gaaaatgctg gaggacctaa atgctggagg tcgaaaacag atcatcgatc
      241 cgagatttga gcggattgga tgtagatatt tttatatcga acataatatt gagaaaaact
      301 gggatgaggc tgcggaaaca tgtcgagaaa tgggcggcta cttggcggct ttcgaaaacc
      361 aagaggaaat cgaagccata atgcagaaac ttaagaaaga gcagtactac tggtactgga
      421 ctggcataaa gcatttggag gaggatggca agttcatatc tacggcctcc gggaagacga
      481 ctaacgtttt taagtggtac agcggacagc ccggaaatag cggtgcatgc gttctgctag
      541 attttatggg gatgcgtgat ttcgattgta ggcttaaaag ttcttttatt tgccaatcag
      601 ataacgaaac ataa