Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153565 847 bp mRNA linear INV 09-DEC-2024 (LOC108065554), mRNA. ACCESSION XM_017153565 VERSION XM_017153565.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153565.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..847 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..847 /gene="LOC108065554" /note="proteasome inhibitor PI31 subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065554" CDS 73..741 /gene="LOC108065554" /codon_start=1 /product="proteasome inhibitor PI31 subunit" /protein_id="XP_017009054.2" /db_xref="GeneID:108065554" /translation="METPDTTSSLSHLSEISLKSLGIGVAGKSGKAEIDSLDWHLLFH SIRPNIRKKSDLLIALIHLLVTKEYRLRGATKAEAITNFSGRQMAGGSGSDLLPQHWN RDAHRYSLNYVDELGSQYVLMAKLSRRDLVISLQNSTSKRMSIACLQPENLVMSTTRS SFGKCLPGVEKIMQRLRFDLVDPAVRGVRKRDPLGLRSVATSSRLTFQHSKSIHALAS EESS" misc_feature 208..642 /gene="LOC108065554" /note="PI31 proteasome regulator N-terminal; Region: PI31_Prot_N; pfam11566" /db_xref="CDD:463296" ORIGIN 1 gcctgtcagt cagttcaaaa ttcactgcgc agtaaagccg aacttcggaa agatgccctc 61 aacttgatca ctatggaaac accagacacc acttcatcac tgtcacatct cagcgagatc 121 tcgctgaaat ctctggggat cggagtagct gggaagagcg ggaaggcgga aatcgattcc 181 ctcgattggc acttgctgtt ccactccatc cggccaaaca ttcgcaagaa gtccgacctg 241 ttgatcgccc tcatccacct gctggtcacc aaggagtacc gcctgcgagg agccaccaag 301 gcggaggcca ttacaaattt cagtggcagg cagatggccg gaggcagtgg cagtgacttg 361 ctgccccaac actggaatcg cgatgcccat cgctactcac tgaactacgt ggatgagctg 421 ggcagccagt acgtcctaat ggccaagctg agtcgtcggg atctggtgat cagcctgcag 481 aactcgacca gcaaacgaat gtccatcgcc tgtctgcagc ccgagaatct ggtgatgtct 541 acgactagat cgtccttcgg gaagtgcctg ccgggggtgg agaagataat gcagcgtctg 601 cgtttcgatc tggtggatcc ggcagtgcgg ggagttcgca agagggatcc tctcggtctc 661 cggtctgtgg cgacatcctc caggttgacc ttccagcaca gcaagagcat ccatgccctg 721 gccagcgagg agtcctctta gaagtggatt ctgttttaaa tctaaccaaa tcttttaatt 781 taatatatag atactagata attcctgaag gaaatgtgat tttatcaaga agataaataa 841 aataaag