Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii proteasome inhibitor PI31 subunit


LOCUS       XM_017153565             847 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065554), mRNA.
ACCESSION   XM_017153565
VERSION     XM_017153565.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153565.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..847
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..847
                     /gene="LOC108065554"
                     /note="proteasome inhibitor PI31 subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108065554"
     CDS             73..741
                     /gene="LOC108065554"
                     /codon_start=1
                     /product="proteasome inhibitor PI31 subunit"
                     /protein_id="XP_017009054.2"
                     /db_xref="GeneID:108065554"
                     /translation="METPDTTSSLSHLSEISLKSLGIGVAGKSGKAEIDSLDWHLLFH
                     SIRPNIRKKSDLLIALIHLLVTKEYRLRGATKAEAITNFSGRQMAGGSGSDLLPQHWN
                     RDAHRYSLNYVDELGSQYVLMAKLSRRDLVISLQNSTSKRMSIACLQPENLVMSTTRS
                     SFGKCLPGVEKIMQRLRFDLVDPAVRGVRKRDPLGLRSVATSSRLTFQHSKSIHALAS
                     EESS"
     misc_feature    208..642
                     /gene="LOC108065554"
                     /note="PI31 proteasome regulator N-terminal; Region:
                     PI31_Prot_N; pfam11566"
                     /db_xref="CDD:463296"
ORIGIN      
        1 gcctgtcagt cagttcaaaa ttcactgcgc agtaaagccg aacttcggaa agatgccctc
       61 aacttgatca ctatggaaac accagacacc acttcatcac tgtcacatct cagcgagatc
      121 tcgctgaaat ctctggggat cggagtagct gggaagagcg ggaaggcgga aatcgattcc
      181 ctcgattggc acttgctgtt ccactccatc cggccaaaca ttcgcaagaa gtccgacctg
      241 ttgatcgccc tcatccacct gctggtcacc aaggagtacc gcctgcgagg agccaccaag
      301 gcggaggcca ttacaaattt cagtggcagg cagatggccg gaggcagtgg cagtgacttg
      361 ctgccccaac actggaatcg cgatgcccat cgctactcac tgaactacgt ggatgagctg
      421 ggcagccagt acgtcctaat ggccaagctg agtcgtcggg atctggtgat cagcctgcag
      481 aactcgacca gcaaacgaat gtccatcgcc tgtctgcagc ccgagaatct ggtgatgtct
      541 acgactagat cgtccttcgg gaagtgcctg ccgggggtgg agaagataat gcagcgtctg
      601 cgtttcgatc tggtggatcc ggcagtgcgg ggagttcgca agagggatcc tctcggtctc
      661 cggtctgtgg cgacatcctc caggttgacc ttccagcaca gcaagagcat ccatgccctg
      721 gccagcgagg agtcctctta gaagtggatt ctgttttaaa tctaaccaaa tcttttaatt
      781 taatatatag atactagata attcctgaag gaaatgtgat tttatcaaga agataaataa
      841 aataaag