Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153552 1154 bp mRNA linear INV 09-DEC-2024 (Prosbeta2R1), transcript variant X1, mRNA. ACCESSION XM_017153552 VERSION XM_017153552.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153552.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1154 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1154 /gene="Prosbeta2R1" /note="Proteasome beta2 subunit-related 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108065544" CDS 98..1072 /gene="Prosbeta2R1" /codon_start=1 /product="proteasome subunit beta type-7 isoform X1" /protein_id="XP_017009041.2" /db_xref="GeneID:108065544" /translation="MLFPFSAPKAAQEKSVDISGMRCGFNFVNCRRNAELLAQGYEPP KAIRTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQNHIYCCGAGTAADT EMMTLMTSSELDMHQLNTGRQVPVVCASMLLRRTLFRYQGHIGAALVMGGVDRTGPQI YCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWRPDLDREQGKQLVREAISAGVFNDLG SGSNIDLCVITRKGAEYLRTDTIASEKGERLGKYGIRPNTTMVTSTSVLSLLVTDERT YGVGSFPSQFSVVADQDQQPGTSGVQGGNPSKEEEEEDLPGGSQKKSL" misc_feature 248..811 /gene="Prosbeta2R1" /note="proteasome beta type-7 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that...; Region: proteasome_beta_type_7; cd03763" /db_xref="CDD:239732" misc_feature order(248..250,296..298,302..304,344..346,632..634, 743..745,752..757) /gene="Prosbeta2R1" /note="active site" /db_xref="CDD:239732" misc_feature order(302..304,311..313,317..334,392..394,398..400, 443..445,479..481,488..493,497..502,509..511,518..520, 587..589,593..595,599..610,617..619,641..646,650..655, 662..670,716..718,737..748,755..760) /gene="Prosbeta2R1" /note="beta subunit interaction site [polypeptide binding]; other site" /db_xref="CDD:239732" misc_feature 821..925 /gene="Prosbeta2R1" /note="Proteasome beta subunits C terminal; Region: Pr_beta_C; pfam12465" /db_xref="CDD:463597" ORIGIN 1 cgtagatatt cctgtctagt taaacgacaa cacaattttc cacataatat tcggaataat 61 aaaacttggt gatttttcat tgtacatttt acacaccatg cttttcccgt tttccgctcc 121 aaaagcggct caggaaaagt ccgtggatat ttctggaatg cgctgcggat tcaattttgt 181 caattgcagg cgaaatgctg agctattggc ccagggctat gagccaccga aagcgattcg 241 cacgggcacc tccattgtgg ggattatcta taaggatggc gttatcctgg gcgccgacac 301 tcgcgccacc gaaggaccca ttgtttccga caagaactgc tcgaaaattc accacctcca 361 gaatcacatt tattgctgtg gagccggaac cgctgccgac actgaaatga tgaccctgat 421 gacctcctcg gagcttgata tgcaccagct gaacaccggg cggcaggtgc cggtggtctg 481 tgccagcatg ctgctccgcc ggaccctctt ccgctaccag ggacacatcg gggccgccct 541 ggtgatgggc ggcgtggaca ggacgggtcc gcagatctac tgcatctatc cgtgcggatc 601 caacgacaag ataccctatg cggccatggg ctcgggtacc ctggcggcga tgtccgtgct 661 ggagcacggc tggcgacccg acttggaccg ggagcagggc aagcagctgg tccgcgaggc 721 catctcggcg ggggtgttca acgatctggg ctccggctcg aatatcgatc tctgcgtgat 781 caccagaaaa ggggcggagt acctgaggac ggacacgatt gccagcgaga agggcgagag 841 gttgggaaaa tacggcataa gacccaacac cacaatggtg acctccacgt cggtgctgag 901 tctactggtc accgatgagc gaacctacgg cgtgggttcg tttccctcgc aattctcggt 961 ggtggcggat caggatcagc agccgggcac cagtggcgtc cagggtggta atcccagcaa 1021 ggaggaggag gaggaggacc tgcccggtgg atcccagaaa aaatcactgt aaccccgtat 1081 ttcccatttc catttgaatt ctagcaaatt aaccgttaac aagccacttg actctacaca 1141 taaatgtaaa aatg