Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Proteasome beta2 subunit-related 1


LOCUS       XM_017153552            1154 bp    mRNA    linear   INV 09-DEC-2024
            (Prosbeta2R1), transcript variant X1, mRNA.
ACCESSION   XM_017153552
VERSION     XM_017153552.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153552.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1154
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1154
                     /gene="Prosbeta2R1"
                     /note="Proteasome beta2 subunit-related 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:108065544"
     CDS             98..1072
                     /gene="Prosbeta2R1"
                     /codon_start=1
                     /product="proteasome subunit beta type-7 isoform X1"
                     /protein_id="XP_017009041.2"
                     /db_xref="GeneID:108065544"
                     /translation="MLFPFSAPKAAQEKSVDISGMRCGFNFVNCRRNAELLAQGYEPP
                     KAIRTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQNHIYCCGAGTAADT
                     EMMTLMTSSELDMHQLNTGRQVPVVCASMLLRRTLFRYQGHIGAALVMGGVDRTGPQI
                     YCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWRPDLDREQGKQLVREAISAGVFNDLG
                     SGSNIDLCVITRKGAEYLRTDTIASEKGERLGKYGIRPNTTMVTSTSVLSLLVTDERT
                     YGVGSFPSQFSVVADQDQQPGTSGVQGGNPSKEEEEEDLPGGSQKKSL"
     misc_feature    248..811
                     /gene="Prosbeta2R1"
                     /note="proteasome beta type-7 subunit. The 20S proteasome,
                     multisubunit proteolytic complex, is the central enzyme of
                     nonlysosomal protein degradation in both the cytosol and
                     nucleus. It is composed of 28 subunits arranged as four
                     homoheptameric rings that...; Region:
                     proteasome_beta_type_7; cd03763"
                     /db_xref="CDD:239732"
     misc_feature    order(248..250,296..298,302..304,344..346,632..634,
                     743..745,752..757)
                     /gene="Prosbeta2R1"
                     /note="active site"
                     /db_xref="CDD:239732"
     misc_feature    order(302..304,311..313,317..334,392..394,398..400,
                     443..445,479..481,488..493,497..502,509..511,518..520,
                     587..589,593..595,599..610,617..619,641..646,650..655,
                     662..670,716..718,737..748,755..760)
                     /gene="Prosbeta2R1"
                     /note="beta subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239732"
     misc_feature    821..925
                     /gene="Prosbeta2R1"
                     /note="Proteasome beta subunits C terminal; Region:
                     Pr_beta_C; pfam12465"
                     /db_xref="CDD:463597"
ORIGIN      
        1 cgtagatatt cctgtctagt taaacgacaa cacaattttc cacataatat tcggaataat
       61 aaaacttggt gatttttcat tgtacatttt acacaccatg cttttcccgt tttccgctcc
      121 aaaagcggct caggaaaagt ccgtggatat ttctggaatg cgctgcggat tcaattttgt
      181 caattgcagg cgaaatgctg agctattggc ccagggctat gagccaccga aagcgattcg
      241 cacgggcacc tccattgtgg ggattatcta taaggatggc gttatcctgg gcgccgacac
      301 tcgcgccacc gaaggaccca ttgtttccga caagaactgc tcgaaaattc accacctcca
      361 gaatcacatt tattgctgtg gagccggaac cgctgccgac actgaaatga tgaccctgat
      421 gacctcctcg gagcttgata tgcaccagct gaacaccggg cggcaggtgc cggtggtctg
      481 tgccagcatg ctgctccgcc ggaccctctt ccgctaccag ggacacatcg gggccgccct
      541 ggtgatgggc ggcgtggaca ggacgggtcc gcagatctac tgcatctatc cgtgcggatc
      601 caacgacaag ataccctatg cggccatggg ctcgggtacc ctggcggcga tgtccgtgct
      661 ggagcacggc tggcgacccg acttggaccg ggagcagggc aagcagctgg tccgcgaggc
      721 catctcggcg ggggtgttca acgatctggg ctccggctcg aatatcgatc tctgcgtgat
      781 caccagaaaa ggggcggagt acctgaggac ggacacgatt gccagcgaga agggcgagag
      841 gttgggaaaa tacggcataa gacccaacac cacaatggtg acctccacgt cggtgctgag
      901 tctactggtc accgatgagc gaacctacgg cgtgggttcg tttccctcgc aattctcggt
      961 ggtggcggat caggatcagc agccgggcac cagtggcgtc cagggtggta atcccagcaa
     1021 ggaggaggag gaggaggacc tgcccggtgg atcccagaaa aaatcactgt aaccccgtat
     1081 ttcccatttc catttgaatt ctagcaaatt aaccgttaac aagccacttg actctacaca
     1141 taaatgtaaa aatg