Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii malignant T-cell-amplified


LOCUS       XM_017153529             818 bp    mRNA    linear   INV 09-DEC-2024
            sequence 1 homolog (MCTS1), mRNA.
ACCESSION   XM_017153529
VERSION     XM_017153529.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153529.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..818
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..818
                     /gene="MCTS1"
                     /note="malignant T-cell-amplified sequence 1 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108065524"
     CDS             97..645
                     /gene="MCTS1"
                     /codon_start=1
                     /product="malignant T-cell-amplified sequence 1 homolog"
                     /protein_id="XP_017009018.1"
                     /db_xref="GeneID:108065524"
                     /translation="MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLETHIDLIL
                     PKKDSYRIAKCHDHIELLLNGAGEQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGA
                     IRFVLSGANVMCPGLTSPGACMTPADKSTVVAIMAEGKEHALAIGLLTLSTQEILAKN
                     KGIGIETYHFLNDGLWKSKPVK"
     misc_feature    106..339
                     /gene="MCTS1"
                     /note="N-terminal domain of multiple copies T cell
                     malignancies 1 and related proteins; Region: MCT1_N;
                     cd11609"
                     /db_xref="CDD:211422"
     misc_feature    order(190..195,310..312,316..318,328..339)
                     /gene="MCTS1"
                     /note="PUA domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:211422"
     misc_feature    337..624
                     /gene="MCTS1"
                     /note="PUA RNA-binding domain of malignant T
                     cell-amplified sequence 1 and related proteins; Region:
                     PUA_MCTS-1-like; cd21155"
                     /db_xref="CDD:409297"
     misc_feature    order(391..393,409..411,415..423,427..435,580..585,
                     595..606)
                     /gene="MCTS1"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:409297"
     polyA_site      818
                     /gene="MCTS1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taccgcacca aacaaagttg gcagcactgg ttgacattca ctccgaaacc atttctcaca
       61 tcagctgcac aggaaaacgc aaggaaatcg tgcaaaatgt tcaaaaagtt cgaggagaag
      121 gacagcattt cgagcatcca gcagctgaag tcgtcggtgc agaagggcat acgtgccaag
      181 ttgctggagg catatcccaa gctggagacg cacatcgacc tgatcctgcc caagaaggac
      241 tcgtaccgca tcgccaagtg ccatgaccac atcgaactgc tgctgaacgg agccggcgaa
      301 caggtgttct tccgccaccg cgatggcccc tggatgccca cgctgcggct cctgcacaag
      361 ttcccctact tcgtgaccat gcagcaggtg gacaagggcg ccatccggtt cgtcctcagc
      421 ggagcgaacg tcatgtgtcc gggcctcacc tcgccgggcg cctgcatgac gccggcggac
      481 aagagcaccg tggtggccat catggccgag ggcaaggagc acgccctggc catcggactc
      541 ctcacgctat ccacacagga aattctggcg aagaacaagg gcatcggcat cgagacgtac
      601 cacttcctca acgacggcct gtggaagtcg aagcccgtga agtaggcgaa ataggaatct
      661 gcacatgcac tttttagtct tctatgtcat gagagcaaag aatggttttt gatatatgca
      721 actgaatcct gtttattatt tttttcctct cctaatttta cactgtcagt taaactattt
      781 aaatcaatgc gaaatataat taatggcatt taaagcgt