Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153529 818 bp mRNA linear INV 09-DEC-2024 sequence 1 homolog (MCTS1), mRNA. ACCESSION XM_017153529 VERSION XM_017153529.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153529.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..818 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..818 /gene="MCTS1" /note="malignant T-cell-amplified sequence 1 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065524" CDS 97..645 /gene="MCTS1" /codon_start=1 /product="malignant T-cell-amplified sequence 1 homolog" /protein_id="XP_017009018.1" /db_xref="GeneID:108065524" /translation="MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLETHIDLIL PKKDSYRIAKCHDHIELLLNGAGEQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGA IRFVLSGANVMCPGLTSPGACMTPADKSTVVAIMAEGKEHALAIGLLTLSTQEILAKN KGIGIETYHFLNDGLWKSKPVK" misc_feature 106..339 /gene="MCTS1" /note="N-terminal domain of multiple copies T cell malignancies 1 and related proteins; Region: MCT1_N; cd11609" /db_xref="CDD:211422" misc_feature order(190..195,310..312,316..318,328..339) /gene="MCTS1" /note="PUA domain interface [polypeptide binding]; other site" /db_xref="CDD:211422" misc_feature 337..624 /gene="MCTS1" /note="PUA RNA-binding domain of malignant T cell-amplified sequence 1 and related proteins; Region: PUA_MCTS-1-like; cd21155" /db_xref="CDD:409297" misc_feature order(391..393,409..411,415..423,427..435,580..585, 595..606) /gene="MCTS1" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:409297" polyA_site 818 /gene="MCTS1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taccgcacca aacaaagttg gcagcactgg ttgacattca ctccgaaacc atttctcaca 61 tcagctgcac aggaaaacgc aaggaaatcg tgcaaaatgt tcaaaaagtt cgaggagaag 121 gacagcattt cgagcatcca gcagctgaag tcgtcggtgc agaagggcat acgtgccaag 181 ttgctggagg catatcccaa gctggagacg cacatcgacc tgatcctgcc caagaaggac 241 tcgtaccgca tcgccaagtg ccatgaccac atcgaactgc tgctgaacgg agccggcgaa 301 caggtgttct tccgccaccg cgatggcccc tggatgccca cgctgcggct cctgcacaag 361 ttcccctact tcgtgaccat gcagcaggtg gacaagggcg ccatccggtt cgtcctcagc 421 ggagcgaacg tcatgtgtcc gggcctcacc tcgccgggcg cctgcatgac gccggcggac 481 aagagcaccg tggtggccat catggccgag ggcaaggagc acgccctggc catcggactc 541 ctcacgctat ccacacagga aattctggcg aagaacaagg gcatcggcat cgagacgtac 601 cacttcctca acgacggcct gtggaagtcg aagcccgtga agtaggcgaa ataggaatct 661 gcacatgcac tttttagtct tctatgtcat gagagcaaag aatggttttt gatatatgca 721 actgaatcct gtttattatt tttttcctct cctaatttta cactgtcagt taaactattt 781 aaatcaatgc gaaatataat taatggcatt taaagcgt