Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii misato mitochondrial distribution


LOCUS       XM_017153515            1886 bp    mRNA    linear   INV 09-DEC-2024
            and morphology regulator (mst), mRNA.
ACCESSION   XM_017153515
VERSION     XM_017153515.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153515.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1886
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1886
                     /gene="mst"
                     /note="misato mitochondrial distribution and morphology
                     regulator; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108065510"
     CDS             79..1800
                     /gene="mst"
                     /codon_start=1
                     /product="protein misato"
                     /protein_id="XP_017009004.2"
                     /db_xref="GeneID:108065510"
                     /translation="MDHTREILTFQFGTYANYVGAHFWNQQEANFRYADEGDQVAEGQ
                     LPNNDILYREGLNALNRTTYTPRLLSVDLAGTLGHLPVAGELYGNFVQRDEELLPLGT
                     GEQLEQARRQAEESGLAGEQLDVQEQPVAAISEYQRDLLKNSVAPEKNYQLAEKANSW
                     ADFLYARYHPRTLNVLPGLVRDPTVQALGTYSAGTELWQEVTFNDEFCDRIRLYVEEC
                     DGLQGFHMLFDIDDGFGGLAGKCLEHLNDEYSRASFVLPLHYPRMTSYAQADPRLSHS
                     IRVVNSVLSYHHLSEQASMFTPLSTLESIWRNHSLKSRSLPGLQWQADNLYQTSALLA
                     AFLDTATLGYRLRQTPESLLRFCERVSPSGRKMTAAGMALPFGLRAGQDLIEFLDQSG
                     DHALLTQLTPGCEPGTSFVMQSVTARGIPAERLKRPRETAGEQLRMAAYNCDSVSHML
                     QLYYQCSYHGSVTNAAATSLPLKTQLPFPYELFGGGISSDGFRLPGGGERESGTRVDS
                     APLLAALQNSSKLGEHLDNLHAQTHRVQLAKLQAYSNSGLERDDYETALDQLLEFRDL
                     YADSQYL"
     misc_feature    91..1785
                     /gene="mst"
                     /note="Misato segment II tubulin-like domain; Region:
                     misato; cd06060"
                     /db_xref="CDD:276964"
     polyA_site      1886
                     /gene="mst"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 catagttttc ggtatatttg gtataaaaag tatttatctt cgagcccggc acaattaatt
       61 gctaattcgc cggctgttat ggaccataca cgtgagattc tgaccttcca gttcggaacg
      121 tacgccaact atgtgggcgc ccacttctgg aaccagcagg aggccaactt caggtacgcc
      181 gacgaaggcg accaggtggc cgagggtcag ctgcccaaca atgacattct ctacagggag
      241 gggctgaatg ccctcaatcg caccacctac acgccccgcc tgctgtccgt ggatttggcc
      301 ggcaccctgg gtcacctgcc ggtcgcgggc gagctgtacg gcaactttgt gcagcgggac
      361 gaggagctgc tgcctctggg cacgggtgag cagctggagc aggctcgccg gcaggcggag
      421 gagagtgggt tggccggcga gcagctggat gtgcaggagc agccggtggc cgccatttcc
      481 gagtaccaga gggatctgct gaagaactcg gtggcgccgg agaagaacta ccagctggcg
      541 gagaaggcaa acagttgggc ggacttcctc tatgcccgct accatccaag gaccctgaat
      601 gtgctgcctg gattggtcag ggatcccacg gtccaggcgc tgggcaccta ctccgccgga
      661 acggagctgt ggcaggaagt caccttcaac gatgagttct gcgatcgcat acgcctgtat
      721 gtggaggagt gcgacggcct gcagggcttc cacatgctct tcgacatcga cgacggcttc
      781 ggcgggctgg ccgggaagtg tctggagcac ctgaacgatg agtacagtcg ggccagcttt
      841 gtgctgccgc tgcactatcc caggatgacc agttatgctc aagcggatcc ccgcctgtcg
      901 cacagcattc gcgtggtgaa cagtgtgctg agctaccacc atctcagcga gcaggcttcc
      961 atgttcacgc cgctgtccac gctggagagc atttggcgca accatagcct taagtcgcgc
     1021 agcctgccgg gactgcagtg gcaggcggat aatctctacc agacatcggc cttgctggcc
     1081 gccttcttgg acaccgccac cttgggctat cgcctgcggc agacgcccga gtcgctgttg
     1141 cgtttctgcg agcgtgtttc gccttcgggc aggaagatga ctgccgccgg catggccttg
     1201 ccatttggtt tgcgggcggg gcaggatctg atcgagtttc tggaccagag cggcgaccat
     1261 gcgctgctca cacaactaac gccgggctgc gaaccgggca cttcgtttgt gatgcaatcg
     1321 gtgacggctc gtggcattcc cgccgagcgt ttgaagcggc caagagagac ggctggcgaa
     1381 caactgcgga tggcagccta taactgcgac agtgtctctc acatgctgca gctgtactac
     1441 cagtgcagct atcatggcag cgtcaccaat gctgcagcca cgtcgctgcc gctgaagacg
     1501 caactgccct ttccttacga gttgtttggc gggggcattt ccagcgatgg cttccgtttg
     1561 cctggcggcg gggaacgcga gtcgggcact cgtgtcgatt ccgcaccctt gctggccgcc
     1621 ctgcagaact ccagcaagct gggcgagcac ctggacaacc tgcacgccca gacgcatcgc
     1681 gtgcagctgg ccaagttgca ggcgtactca aattctggcc tggagcggga tgattacgag
     1741 acggcgctgg atcagctgct cgagttccgg gacctctatg cagactcgca gtatctgtag
     1801 gatgtgggaa tccagtattt tgggggaaca cgattttgtg ataggccgta ggataataaa
     1861 cacactcata tgcttttgaa tactaa