Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153514 1147 bp mRNA linear INV 09-DEC-2024 variant X3, mRNA. ACCESSION XM_017153514 VERSION XM_017153514.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153514.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1147 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1147 /gene="Syx4" /note="Syntaxin 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065509" CDS 303..1076 /gene="Syx4" /codon_start=1 /product="syntaxin-4 isoform X2" /protein_id="XP_017009003.1" /db_xref="GeneID:108065509" /translation="MAQYGSNVDDILNPYTEIRQQLAQIAGNLEAMNRMSQTINLRTF NENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKRTLFYGLHQTFINLW HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER QTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKG ADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL" misc_feature <633..1013 /gene="Syx4" /note="t-SNARE complex subunit, syntaxin [Intracellular trafficking, secretion, and vesicular transport]; Region: COG5074" /db_xref="CDD:227406" misc_feature 786..968 /gene="Syx4" /note="SNARE motif of syntaxin 1 and related proteins; Region: SNARE_syntaxin1-like; cd15848" /db_xref="CDD:277201" misc_feature order(786..791,795..812,816..833,837..854,858..866, 870..875,879..887,891..896,900..917,921..926,933..938, 942..959,963..968) /gene="Syx4" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277201" misc_feature 891..893 /gene="Syx4" /note="zero layer; other site" /db_xref="CDD:277201" polyA_site 1147 /gene="Syx4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcacacttac gggaaaccac cccccgatgg ccccacaaac ttttagcact aagtgaattt 61 cagtgccgaa gtcattttta ttgttcattt acaccgcgcc agattgtgaa ctcacaaacc 121 gctcactgag cacgaactcg acgaattcgt cgtccaacgg ttcactgcta ttaaacgtgt 181 acagtggaac cacggagttc atcatcaaca acaccggcgg gaacaataat agttacagtg 241 tggtcagcca aaacaacaac atcaatacta gtggcgaaac caaggatcga tccagtgcaa 301 aaatggcgca gtatggatcg aatgtggacg atatactcaa tccgtacacg gagatacgcc 361 aacaactcgc acagatagcc ggcaatttgg aggcgatgaa ccgcatgtcc caaacgataa 421 atctgcgaac gttcaacgag aacgagatgg atgagcttca caacaaaaac ctgaggctgg 481 gcaatacgct gatgacgaga ttcaaggact tcaaggcaaa tcttcctgcg gaaaacgact 541 acagtttgga ggcgaggatg aaaaggaccc tcttttacgg cctccaccag actttcatca 601 atctctggca taagaacgaa cttttcctgc agaattacga gaccaaagtc aaaaagaatc 661 tgagactgca tacgaaaatc attaattcag aagccagcga acaagaaatc gagttactca 721 tcgagaacaa gacaacaaaa ctctttgtgg acaatttcct gcaggaaacg gagaaggagc 781 ggcagacact gcgcgaaatg atggacagat tcaacgagct gcgccgcctg gagaagtcca 841 tcgaggaggt ccacgccctg ttcatgcgca tccagacctt ggtgatggag cagagcgaag 901 tgatccagcg ggtggagttc cacgcccagc aggccaccct ccacgtggac aagggggcgg 961 acgaactgga ccaggcggaa cagcaccaga aaagggcgcg aaagaaaaag ataatgctca 1021 tcgcgatact tgcagcaatt ttgttagtat tactcttcgt tggtatttat ttgtgatgca 1081 cctgcgacaa ctattttttt gcttattttt aagaattatt tttaagaaaa taaactttaa 1141 aaccaca