Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Syntaxin 4 (Syx4), transcript


LOCUS       XM_017153514            1147 bp    mRNA    linear   INV 09-DEC-2024
            variant X3, mRNA.
ACCESSION   XM_017153514
VERSION     XM_017153514.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153514.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1147
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1147
                     /gene="Syx4"
                     /note="Syntaxin 4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108065509"
     CDS             303..1076
                     /gene="Syx4"
                     /codon_start=1
                     /product="syntaxin-4 isoform X2"
                     /protein_id="XP_017009003.1"
                     /db_xref="GeneID:108065509"
                     /translation="MAQYGSNVDDILNPYTEIRQQLAQIAGNLEAMNRMSQTINLRTF
                     NENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKRTLFYGLHQTFINLW
                     HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER
                     QTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKG
                     ADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL"
     misc_feature    <633..1013
                     /gene="Syx4"
                     /note="t-SNARE complex subunit, syntaxin [Intracellular
                     trafficking, secretion, and vesicular transport]; Region:
                     COG5074"
                     /db_xref="CDD:227406"
     misc_feature    786..968
                     /gene="Syx4"
                     /note="SNARE motif of syntaxin 1 and related proteins;
                     Region: SNARE_syntaxin1-like; cd15848"
                     /db_xref="CDD:277201"
     misc_feature    order(786..791,795..812,816..833,837..854,858..866,
                     870..875,879..887,891..896,900..917,921..926,933..938,
                     942..959,963..968)
                     /gene="Syx4"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277201"
     misc_feature    891..893
                     /gene="Syx4"
                     /note="zero layer; other site"
                     /db_xref="CDD:277201"
     polyA_site      1147
                     /gene="Syx4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcacacttac gggaaaccac cccccgatgg ccccacaaac ttttagcact aagtgaattt
       61 cagtgccgaa gtcattttta ttgttcattt acaccgcgcc agattgtgaa ctcacaaacc
      121 gctcactgag cacgaactcg acgaattcgt cgtccaacgg ttcactgcta ttaaacgtgt
      181 acagtggaac cacggagttc atcatcaaca acaccggcgg gaacaataat agttacagtg
      241 tggtcagcca aaacaacaac atcaatacta gtggcgaaac caaggatcga tccagtgcaa
      301 aaatggcgca gtatggatcg aatgtggacg atatactcaa tccgtacacg gagatacgcc
      361 aacaactcgc acagatagcc ggcaatttgg aggcgatgaa ccgcatgtcc caaacgataa
      421 atctgcgaac gttcaacgag aacgagatgg atgagcttca caacaaaaac ctgaggctgg
      481 gcaatacgct gatgacgaga ttcaaggact tcaaggcaaa tcttcctgcg gaaaacgact
      541 acagtttgga ggcgaggatg aaaaggaccc tcttttacgg cctccaccag actttcatca
      601 atctctggca taagaacgaa cttttcctgc agaattacga gaccaaagtc aaaaagaatc
      661 tgagactgca tacgaaaatc attaattcag aagccagcga acaagaaatc gagttactca
      721 tcgagaacaa gacaacaaaa ctctttgtgg acaatttcct gcaggaaacg gagaaggagc
      781 ggcagacact gcgcgaaatg atggacagat tcaacgagct gcgccgcctg gagaagtcca
      841 tcgaggaggt ccacgccctg ttcatgcgca tccagacctt ggtgatggag cagagcgaag
      901 tgatccagcg ggtggagttc cacgcccagc aggccaccct ccacgtggac aagggggcgg
      961 acgaactgga ccaggcggaa cagcaccaga aaagggcgcg aaagaaaaag ataatgctca
     1021 tcgcgatact tgcagcaatt ttgttagtat tactcttcgt tggtatttat ttgtgatgca
     1081 cctgcgacaa ctattttttt gcttattttt aagaattatt tttaagaaaa taaactttaa
     1141 aaccaca