Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Syntaxin 4 (Syx4), transcript


LOCUS       XM_017153512            1069 bp    mRNA    linear   INV 09-DEC-2024
            variant X2, mRNA.
ACCESSION   XM_017153512
VERSION     XM_017153512.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153512.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1069
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1069
                     /gene="Syx4"
                     /note="Syntaxin 4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108065509"
     CDS             225..998
                     /gene="Syx4"
                     /codon_start=1
                     /product="syntaxin-4 isoform X2"
                     /protein_id="XP_017009001.1"
                     /db_xref="GeneID:108065509"
                     /translation="MAQYGSNVDDILNPYTEIRQQLAQIAGNLEAMNRMSQTINLRTF
                     NENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKRTLFYGLHQTFINLW
                     HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER
                     QTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKG
                     ADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL"
     misc_feature    <555..935
                     /gene="Syx4"
                     /note="t-SNARE complex subunit, syntaxin [Intracellular
                     trafficking, secretion, and vesicular transport]; Region:
                     COG5074"
                     /db_xref="CDD:227406"
     misc_feature    708..890
                     /gene="Syx4"
                     /note="SNARE motif of syntaxin 1 and related proteins;
                     Region: SNARE_syntaxin1-like; cd15848"
                     /db_xref="CDD:277201"
     misc_feature    order(708..713,717..734,738..755,759..776,780..788,
                     792..797,801..809,813..818,822..839,843..848,855..860,
                     864..881,885..890)
                     /gene="Syx4"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277201"
     misc_feature    813..815
                     /gene="Syx4"
                     /note="zero layer; other site"
                     /db_xref="CDD:277201"
     polyA_site      1069
                     /gene="Syx4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gccagattgt gaactcacaa acgtaaataa actcaaccaa acgctcactg agcacgaact
       61 cgacgaattc gtcgtccaac ggttcactgc tattaaacgt gtacagtgga accacggagt
      121 tcatcatcaa caacaccggc gggaacaata atagttacag tgtggtcagc caaaacaaca
      181 acatcaatac tagtggcgaa accaaggatc gatccagtgc aaaaatggcg cagtatggat
      241 cgaatgtgga cgatatactc aatccgtaca cggagatacg ccaacaactc gcacagatag
      301 ccggcaattt ggaggcgatg aaccgcatgt cccaaacgat aaatctgcga acgttcaacg
      361 agaacgagat ggatgagctt cacaacaaaa acctgaggct gggcaatacg ctgatgacga
      421 gattcaagga cttcaaggca aatcttcctg cggaaaacga ctacagtttg gaggcgagga
      481 tgaaaaggac cctcttttac ggcctccacc agactttcat caatctctgg cataagaacg
      541 aacttttcct gcagaattac gagaccaaag tcaaaaagaa tctgagactg catacgaaaa
      601 tcattaattc agaagccagc gaacaagaaa tcgagttact catcgagaac aagacaacaa
      661 aactctttgt ggacaatttc ctgcaggaaa cggagaagga gcggcagaca ctgcgcgaaa
      721 tgatggacag attcaacgag ctgcgccgcc tggagaagtc catcgaggag gtccacgccc
      781 tgttcatgcg catccagacc ttggtgatgg agcagagcga agtgatccag cgggtggagt
      841 tccacgccca gcaggccacc ctccacgtgg acaagggggc ggacgaactg gaccaggcgg
      901 aacagcacca gaaaagggcg cgaaagaaaa agataatgct catcgcgata cttgcagcaa
      961 ttttgttagt attactcttc gttggtattt atttgtgatg cacctgcgac aactattttt
     1021 ttgcttattt ttaagaatta tttttaagaa aataaacttt aaaaccaca