Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153512 1069 bp mRNA linear INV 09-DEC-2024 variant X2, mRNA. ACCESSION XM_017153512 VERSION XM_017153512.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153512.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1069 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1069 /gene="Syx4" /note="Syntaxin 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065509" CDS 225..998 /gene="Syx4" /codon_start=1 /product="syntaxin-4 isoform X2" /protein_id="XP_017009001.1" /db_xref="GeneID:108065509" /translation="MAQYGSNVDDILNPYTEIRQQLAQIAGNLEAMNRMSQTINLRTF NENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKRTLFYGLHQTFINLW HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER QTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKG ADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL" misc_feature <555..935 /gene="Syx4" /note="t-SNARE complex subunit, syntaxin [Intracellular trafficking, secretion, and vesicular transport]; Region: COG5074" /db_xref="CDD:227406" misc_feature 708..890 /gene="Syx4" /note="SNARE motif of syntaxin 1 and related proteins; Region: SNARE_syntaxin1-like; cd15848" /db_xref="CDD:277201" misc_feature order(708..713,717..734,738..755,759..776,780..788, 792..797,801..809,813..818,822..839,843..848,855..860, 864..881,885..890) /gene="Syx4" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277201" misc_feature 813..815 /gene="Syx4" /note="zero layer; other site" /db_xref="CDD:277201" polyA_site 1069 /gene="Syx4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gccagattgt gaactcacaa acgtaaataa actcaaccaa acgctcactg agcacgaact 61 cgacgaattc gtcgtccaac ggttcactgc tattaaacgt gtacagtgga accacggagt 121 tcatcatcaa caacaccggc gggaacaata atagttacag tgtggtcagc caaaacaaca 181 acatcaatac tagtggcgaa accaaggatc gatccagtgc aaaaatggcg cagtatggat 241 cgaatgtgga cgatatactc aatccgtaca cggagatacg ccaacaactc gcacagatag 301 ccggcaattt ggaggcgatg aaccgcatgt cccaaacgat aaatctgcga acgttcaacg 361 agaacgagat ggatgagctt cacaacaaaa acctgaggct gggcaatacg ctgatgacga 421 gattcaagga cttcaaggca aatcttcctg cggaaaacga ctacagtttg gaggcgagga 481 tgaaaaggac cctcttttac ggcctccacc agactttcat caatctctgg cataagaacg 541 aacttttcct gcagaattac gagaccaaag tcaaaaagaa tctgagactg catacgaaaa 601 tcattaattc agaagccagc gaacaagaaa tcgagttact catcgagaac aagacaacaa 661 aactctttgt ggacaatttc ctgcaggaaa cggagaagga gcggcagaca ctgcgcgaaa 721 tgatggacag attcaacgag ctgcgccgcc tggagaagtc catcgaggag gtccacgccc 781 tgttcatgcg catccagacc ttggtgatgg agcagagcga agtgatccag cgggtggagt 841 tccacgccca gcaggccacc ctccacgtgg acaagggggc ggacgaactg gaccaggcgg 901 aacagcacca gaaaagggcg cgaaagaaaa agataatgct catcgcgata cttgcagcaa 961 ttttgttagt attactcttc gttggtattt atttgtgatg cacctgcgac aactattttt 1021 ttgcttattt ttaagaatta tttttaagaa aataaacttt aaaaccaca