Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Syntaxin 4 (Syx4), transcript


LOCUS       XM_017153511            1661 bp    mRNA    linear   INV 09-DEC-2024
            variant X1, mRNA.
ACCESSION   XM_017153511
VERSION     XM_017153511.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153511.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1661
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1661
                     /gene="Syx4"
                     /note="Syntaxin 4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108065509"
     CDS             601..1590
                     /gene="Syx4"
                     /codon_start=1
                     /product="syntaxin-4 isoform X1"
                     /protein_id="XP_017009000.2"
                     /db_xref="GeneID:108065509"
                     /translation="MGKDRLPELLQRSLSTNSTNSSSNGSLLLNVYSGTTEFIINNTG
                     GNNNSYSVVSQNNNINTSGETKDRSSAKMAQYGSNVDDILNPYTEIRQQLAQIAGNLE
                     AMNRMSQTINLRTFNENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKR
                     TLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTK
                     LFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRV
                     EFHAQQATLHVDKGADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL"
     misc_feature    <1147..1527
                     /gene="Syx4"
                     /note="t-SNARE complex subunit, syntaxin [Intracellular
                     trafficking, secretion, and vesicular transport]; Region:
                     COG5074"
                     /db_xref="CDD:227406"
     misc_feature    1300..1482
                     /gene="Syx4"
                     /note="SNARE motif of syntaxin 1 and related proteins;
                     Region: SNARE_syntaxin1-like; cd15848"
                     /db_xref="CDD:277201"
     misc_feature    order(1300..1305,1309..1326,1330..1347,1351..1368,
                     1372..1380,1384..1389,1393..1401,1405..1410,1414..1431,
                     1435..1440,1447..1452,1456..1473,1477..1482)
                     /gene="Syx4"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277201"
     misc_feature    1405..1407
                     /gene="Syx4"
                     /note="zero layer; other site"
                     /db_xref="CDD:277201"
     polyA_site      1661
                     /gene="Syx4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaacgaatg cggcgcggtc aagacaaagg aatcgatttt caataaatcg aaaagcggca
       61 gaaaatgtag cggaaaaatc gtacaaaaat ttgtaaaaat aaaggaaagc cgtttttcaa
      121 ataatccgaa ttattttgtg tttttgtgtc tgtggaaaag tgtgctgaaa cgcgagagcg
      181 agaaagagag aagaaagagc ggcaaataaa tggcaaaaag gtgataagtg ataaccgctg
      241 tctctctcca tcgccatatt cctgtctctt tcccattttc tacccctctc tttcgccttg
      301 tgaagggcat tccgtaaata tttaggcgtt tcttatcgga agcccgccag ctgataagct
      361 ttgataacag acaatgcgac aagtttcact ctcttcgccg ctctcaatct taattttccc
      421 attcgcgaac agctgttaaa ggcaacaaca acagcaaaaa ttaagaacaa agctcaaaca
      481 gaccgctgca aaaaatattg taaaggaaat tctcaagccc ctgaaacagg aacaaaaaat
      541 acattttttt aaatatattt ttaaacagtt aaaataaaag tcaatagaaa aaatacaaaa
      601 atgggaaaag atcgactgcc tgagctttta cagcgctcac tgagcacgaa ctcgacgaat
      661 tcgtcgtcca acggttcact gctattaaac gtgtacagtg gaaccacgga gttcatcatc
      721 aacaacaccg gcgggaacaa taatagttac agtgtggtca gccaaaacaa caacatcaat
      781 actagtggcg aaaccaagga tcgatccagt gcaaaaatgg cgcagtatgg atcgaatgtg
      841 gacgatatac tcaatccgta cacggagata cgccaacaac tcgcacagat agccggcaat
      901 ttggaggcga tgaaccgcat gtcccaaacg ataaatctgc gaacgttcaa cgagaacgag
      961 atggatgagc ttcacaacaa aaacctgagg ctgggcaata cgctgatgac gagattcaag
     1021 gacttcaagg caaatcttcc tgcggaaaac gactacagtt tggaggcgag gatgaaaagg
     1081 accctctttt acggcctcca ccagactttc atcaatctct ggcataagaa cgaacttttc
     1141 ctgcagaatt acgagaccaa agtcaaaaag aatctgagac tgcatacgaa aatcattaat
     1201 tcagaagcca gcgaacaaga aatcgagtta ctcatcgaga acaagacaac aaaactcttt
     1261 gtggacaatt tcctgcagga aacggagaag gagcggcaga cactgcgcga aatgatggac
     1321 agattcaacg agctgcgccg cctggagaag tccatcgagg aggtccacgc cctgttcatg
     1381 cgcatccaga ccttggtgat ggagcagagc gaagtgatcc agcgggtgga gttccacgcc
     1441 cagcaggcca ccctccacgt ggacaagggg gcggacgaac tggaccaggc ggaacagcac
     1501 cagaaaaggg cgcgaaagaa aaagataatg ctcatcgcga tacttgcagc aattttgtta
     1561 gtattactct tcgttggtat ttatttgtga tgcacctgcg acaactattt ttttgcttat
     1621 ttttaagaat tatttttaag aaaataaact ttaaaaccac a