Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153511 1661 bp mRNA linear INV 09-DEC-2024 variant X1, mRNA. ACCESSION XM_017153511 VERSION XM_017153511.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153511.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1661 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1661 /gene="Syx4" /note="Syntaxin 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108065509" CDS 601..1590 /gene="Syx4" /codon_start=1 /product="syntaxin-4 isoform X1" /protein_id="XP_017009000.2" /db_xref="GeneID:108065509" /translation="MGKDRLPELLQRSLSTNSTNSSSNGSLLLNVYSGTTEFIINNTG GNNNSYSVVSQNNNINTSGETKDRSSAKMAQYGSNVDDILNPYTEIRQQLAQIAGNLE AMNRMSQTINLRTFNENEMDELHNKNLRLGNTLMTRFKDFKANLPAENDYSLEARMKR TLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTK LFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRV EFHAQQATLHVDKGADELDQAEQHQKRARKKKIMLIAILAAILLVLLFVGIYL" misc_feature <1147..1527 /gene="Syx4" /note="t-SNARE complex subunit, syntaxin [Intracellular trafficking, secretion, and vesicular transport]; Region: COG5074" /db_xref="CDD:227406" misc_feature 1300..1482 /gene="Syx4" /note="SNARE motif of syntaxin 1 and related proteins; Region: SNARE_syntaxin1-like; cd15848" /db_xref="CDD:277201" misc_feature order(1300..1305,1309..1326,1330..1347,1351..1368, 1372..1380,1384..1389,1393..1401,1405..1410,1414..1431, 1435..1440,1447..1452,1456..1473,1477..1482) /gene="Syx4" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277201" misc_feature 1405..1407 /gene="Syx4" /note="zero layer; other site" /db_xref="CDD:277201" polyA_site 1661 /gene="Syx4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaacgaatg cggcgcggtc aagacaaagg aatcgatttt caataaatcg aaaagcggca 61 gaaaatgtag cggaaaaatc gtacaaaaat ttgtaaaaat aaaggaaagc cgtttttcaa 121 ataatccgaa ttattttgtg tttttgtgtc tgtggaaaag tgtgctgaaa cgcgagagcg 181 agaaagagag aagaaagagc ggcaaataaa tggcaaaaag gtgataagtg ataaccgctg 241 tctctctcca tcgccatatt cctgtctctt tcccattttc tacccctctc tttcgccttg 301 tgaagggcat tccgtaaata tttaggcgtt tcttatcgga agcccgccag ctgataagct 361 ttgataacag acaatgcgac aagtttcact ctcttcgccg ctctcaatct taattttccc 421 attcgcgaac agctgttaaa ggcaacaaca acagcaaaaa ttaagaacaa agctcaaaca 481 gaccgctgca aaaaatattg taaaggaaat tctcaagccc ctgaaacagg aacaaaaaat 541 acattttttt aaatatattt ttaaacagtt aaaataaaag tcaatagaaa aaatacaaaa 601 atgggaaaag atcgactgcc tgagctttta cagcgctcac tgagcacgaa ctcgacgaat 661 tcgtcgtcca acggttcact gctattaaac gtgtacagtg gaaccacgga gttcatcatc 721 aacaacaccg gcgggaacaa taatagttac agtgtggtca gccaaaacaa caacatcaat 781 actagtggcg aaaccaagga tcgatccagt gcaaaaatgg cgcagtatgg atcgaatgtg 841 gacgatatac tcaatccgta cacggagata cgccaacaac tcgcacagat agccggcaat 901 ttggaggcga tgaaccgcat gtcccaaacg ataaatctgc gaacgttcaa cgagaacgag 961 atggatgagc ttcacaacaa aaacctgagg ctgggcaata cgctgatgac gagattcaag 1021 gacttcaagg caaatcttcc tgcggaaaac gactacagtt tggaggcgag gatgaaaagg 1081 accctctttt acggcctcca ccagactttc atcaatctct ggcataagaa cgaacttttc 1141 ctgcagaatt acgagaccaa agtcaaaaag aatctgagac tgcatacgaa aatcattaat 1201 tcagaagcca gcgaacaaga aatcgagtta ctcatcgaga acaagacaac aaaactcttt 1261 gtggacaatt tcctgcagga aacggagaag gagcggcaga cactgcgcga aatgatggac 1321 agattcaacg agctgcgccg cctggagaag tccatcgagg aggtccacgc cctgttcatg 1381 cgcatccaga ccttggtgat ggagcagagc gaagtgatcc agcgggtgga gttccacgcc 1441 cagcaggcca ccctccacgt ggacaagggg gcggacgaac tggaccaggc ggaacagcac 1501 cagaaaaggg cgcgaaagaa aaagataatg ctcatcgcga tacttgcagc aattttgtta 1561 gtattactct tcgttggtat ttatttgtga tgcacctgcg acaactattt ttttgcttat 1621 ttttaagaat tatttttaag aaaataaact ttaaaaccac a