Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153507 1065 bp mRNA linear INV 09-DEC-2024 RTF1 homolog (LOC108065507), mRNA. ACCESSION XM_017153507 VERSION XM_017153507.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153507.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1065 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1065 /gene="LOC108065507" /note="RNA polymerase-associated protein RTF1 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065507" CDS 128..946 /gene="LOC108065507" /codon_start=1 /product="RNA polymerase-associated protein RTF1 homolog" /protein_id="XP_017008996.2" /db_xref="GeneID:108065507" /translation="MSGQRIRRNRRPAAEIVRELRHLRSSPLRIDDEDESWMEGHERP PTPDLPVASRDQLEQLRLSRHRIGLLLVRPAFEQAVSGCFVRVNVNGQEELPDYRIAE VLGLGELDYGYKVGEIPTNLALRLRYEDLVMLHEINDVSNLVFTQEEFELWRDNCVNQ ALSPPTSHMVTRKKIELYNALQCEAKALSLIQRTFSFALRPAQKCSIVERHGAVYPWR LKHPLPLIPQPPPLPPPENPPRGLTYRIQPKSIASVLQGEEDALPLPRSEPDGN" misc_feature 278..598 /gene="LOC108065507" /note="Short conserved domain in transcriptional regulators; Region: Plus3; smart00719" /db_xref="CDD:197843" polyA_site 1065 /gene="LOC108065507" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatttcccgt ctccccgatc cagttgtcac tactcatttt ttggtccagg caaatcctaa 61 aagtcaccga aaaattattt aaatgtttag cccaccattt ggcggcggag taaagcaatc 121 cctttgaatg tccggccagc gaatccggcg gaaccgtcgt ccggcggcgg aaatagtccg 181 tgaactgcgc caccttcgct cctctccgct gcgaatcgac gacgaggacg agtcctggat 241 ggagggccac gagaggccgc ccactccgga tctcccggtg gccagtcgcg atcagttgga 301 gcagctgcgt ctgagtcgcc atcgcatcgg cctgctgctg gttcgtcccg ccttcgagca 361 ggccgtctcc ggttgctttg tccgggtgaa tgtgaatggg caggaggagt tgcccgacta 421 tcggattgcc gaggttctgg gcctcgggga attggactat ggctacaaag tcggcgagat 481 acccacgaat ttggccctgc gcctgcgcta cgaggatctc gtgatgctgc acgagatcaa 541 cgatgtctcc aacttggtct tcacccagga ggagttcgag ttgtggcgcg ataattgcgt 601 taaccaggcc ctcagtccac ccaccagcca catggtgacg cgcaagaaga tcgagctgta 661 caacgccctg cagtgcgagg ccaaggcatt gtccttgatc caaaggacct tctccttcgc 721 cctgaggcca gcgcagaaat gtagcatcgt ggagcgccat ggcgccgtct atccttggcg 781 attgaagcat ccgctgccgt tgatcccgca accgccgcca ttgccaccgc ctgaaaatcc 841 gcccaggggt ctcacctacc gcatccaacc gaaatccata gcctcggttc tccaggggga 901 ggaagatgca ctgccattac caagatctga accggacgga aattagccaa caatgttata 961 tattaataca cattaataca caccataatc acatttattt tacaaatatt tctggctgcg 1021 aaacctgttc gtttaatgcc attagttttt ctgagtgtat tatta