Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RNA polymerase-associated protein


LOCUS       XM_017153507            1065 bp    mRNA    linear   INV 09-DEC-2024
            RTF1 homolog (LOC108065507), mRNA.
ACCESSION   XM_017153507
VERSION     XM_017153507.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153507.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1065
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1065
                     /gene="LOC108065507"
                     /note="RNA polymerase-associated protein RTF1 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108065507"
     CDS             128..946
                     /gene="LOC108065507"
                     /codon_start=1
                     /product="RNA polymerase-associated protein RTF1 homolog"
                     /protein_id="XP_017008996.2"
                     /db_xref="GeneID:108065507"
                     /translation="MSGQRIRRNRRPAAEIVRELRHLRSSPLRIDDEDESWMEGHERP
                     PTPDLPVASRDQLEQLRLSRHRIGLLLVRPAFEQAVSGCFVRVNVNGQEELPDYRIAE
                     VLGLGELDYGYKVGEIPTNLALRLRYEDLVMLHEINDVSNLVFTQEEFELWRDNCVNQ
                     ALSPPTSHMVTRKKIELYNALQCEAKALSLIQRTFSFALRPAQKCSIVERHGAVYPWR
                     LKHPLPLIPQPPPLPPPENPPRGLTYRIQPKSIASVLQGEEDALPLPRSEPDGN"
     misc_feature    278..598
                     /gene="LOC108065507"
                     /note="Short conserved domain in transcriptional
                     regulators; Region: Plus3; smart00719"
                     /db_xref="CDD:197843"
     polyA_site      1065
                     /gene="LOC108065507"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatttcccgt ctccccgatc cagttgtcac tactcatttt ttggtccagg caaatcctaa
       61 aagtcaccga aaaattattt aaatgtttag cccaccattt ggcggcggag taaagcaatc
      121 cctttgaatg tccggccagc gaatccggcg gaaccgtcgt ccggcggcgg aaatagtccg
      181 tgaactgcgc caccttcgct cctctccgct gcgaatcgac gacgaggacg agtcctggat
      241 ggagggccac gagaggccgc ccactccgga tctcccggtg gccagtcgcg atcagttgga
      301 gcagctgcgt ctgagtcgcc atcgcatcgg cctgctgctg gttcgtcccg ccttcgagca
      361 ggccgtctcc ggttgctttg tccgggtgaa tgtgaatggg caggaggagt tgcccgacta
      421 tcggattgcc gaggttctgg gcctcgggga attggactat ggctacaaag tcggcgagat
      481 acccacgaat ttggccctgc gcctgcgcta cgaggatctc gtgatgctgc acgagatcaa
      541 cgatgtctcc aacttggtct tcacccagga ggagttcgag ttgtggcgcg ataattgcgt
      601 taaccaggcc ctcagtccac ccaccagcca catggtgacg cgcaagaaga tcgagctgta
      661 caacgccctg cagtgcgagg ccaaggcatt gtccttgatc caaaggacct tctccttcgc
      721 cctgaggcca gcgcagaaat gtagcatcgt ggagcgccat ggcgccgtct atccttggcg
      781 attgaagcat ccgctgccgt tgatcccgca accgccgcca ttgccaccgc ctgaaaatcc
      841 gcccaggggt ctcacctacc gcatccaacc gaaatccata gcctcggttc tccaggggga
      901 ggaagatgca ctgccattac caagatctga accggacgga aattagccaa caatgttata
      961 tattaataca cattaataca caccataatc acatttattt tacaaatatt tctggctgcg
     1021 aaacctgttc gtttaatgcc attagttttt ctgagtgtat tatta