Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii low affinity immunoglobulin


LOCUS       XM_017153506            1540 bp    mRNA    linear   INV 09-DEC-2024
            epsilon Fc receptor-like (LOC108065506), mRNA.
ACCESSION   XM_017153506
VERSION     XM_017153506.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153506.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1540
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1540
                     /gene="LOC108065506"
                     /note="low affinity immunoglobulin epsilon Fc
                     receptor-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108065506"
     CDS             32..1114
                     /gene="LOC108065506"
                     /codon_start=1
                     /product="low affinity immunoglobulin epsilon Fc
                     receptor-like"
                     /protein_id="XP_017008995.2"
                     /db_xref="GeneID:108065506"
                     /translation="MEKLAYLFLGFLLTLANCQDNNGYICALSDPANQCGQFCLSQLH
                     PVLNMIPETEIKLDRIQEEQQIIQERLQAVQFWLQVQWTIIKGNLKEMTPEVFEARLN
                     ETEKQLLALISETKIQFNGLQNMIKEQKSVIQSQLDGQLLEVQAKLDKQNQALEESCK
                     RAPASEDFERIFNRTEGHLQDLLKPLDSALKNQLQLLQTKMESQMVELKSDMGSQFAA
                     LQDSLKAKLQVLPAKMEEQQAAFQQIGTRYFYIENKYKLNWVSAASTCRKMGGHLASI
                     KDQRELNVLEPKLNGRYWLGTNDREKEGQFVSEASGKKPYLKWWPGEPNDLNGNEDCV
                     QLDRGLMNDIDCARESYFICQSDNEI"
     misc_feature    <296..>805
                     /gene="LOC108065506"
                     /note="Exopolysaccharide export protein/domain GumC/Wzc1
                     [Cell wall/membrane/envelope biogenesis]; Region: GumC;
                     COG3206"
                     /db_xref="CDD:442439"
     misc_feature    773..1096
                     /gene="LOC108065506"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(1022..1024,1034..1036,1040..1042,1049..1051,
                     1055..1066,1073..1081)
                     /gene="LOC108065506"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 gttcacgtcg tttggttgta tctttttcag aatggagaag ctagcatacc ttttcttggg
       61 gtttcttctc acattggcga actgccagga taataatgga tacatttgtg cactaagcga
      121 tcctgcaaat cagtgtggac agttctgcct cagtcaactg catccggtac tcaatatgat
      181 tcctgaaacg gagataaagc tggacaggat ccaagaggag cagcagatta ttcaggagag
      241 acttcaggca gtccagtttt ggctgcaggt ccagtggaca ataatcaagg gaaacctgaa
      301 ggagatgacc cccgaagtct tcgaggcgag gctaaacgaa acggagaaac agcttttggc
      361 gctaatttcc gaaactaaga tccaatttaa tgggctgcag aacatgatta aggaacagaa
      421 atcagttatt caaagtcagt tggatggcca gctccttgaa gtccaggcaa aactggataa
      481 acagaaccaa gcgcttgaag agtcctgcaa aagagcccca gcgtccgagg atttcgagag
      541 gattttcaac cgaacggagg gacatctgca ggaccttttg aaacccctgg attccgcact
      601 gaagaaccaa ctccaattgc ttcaaaccaa aatggaaagc cagatggtag agctgaaatc
      661 cgatatggga agccaatttg cggctcttca ggattccctg aaggcaaaac tacaggtact
      721 gccggccaaa atggaagagc aacaagcagc ctttcagcaa atcggaactc ggtacttcta
      781 catagagaat aaatataagc tcaactgggt ttcggctgcc tccacgtgcc gcaaaatggg
      841 tggacatctg gcatcgatca aggaccaacg ggaactgaat gtcctggagc ccaaactcaa
      901 tggtcgctac tggctgggca ccaacgatcg ggaaaaggag ggccagttcg tatccgaagc
      961 ttccggcaag aaaccatatt tgaagtggtg gcccggagag cccaacgatt tgaatggcaa
     1021 cgaggattgt gtgcaactgg atagaggact aatgaacgat atcgattgtg ccagggaatc
     1081 gtatttcatt tgccaatcgg acaatgaaat atagataaaa cgaatactaa tttcgaaagg
     1141 tggctcttta aatagaatta tggattttca ttcctcgctc tgcttttttt aattttctcg
     1201 attgctgtcc cagtttttac atttcagtag ggcattgatc taacaaactg gatttataaa
     1261 tttattataa aacaaagccc cactcttatg gttttttttt ggttggtacc tcttgcccca
     1321 acttttccct caactgcatc gtatccttct tcaacttgaa tctttatcca cctctatcat
     1381 cgttggtgca ctgaaaaata tccagagctc aaaaatcaat aaaaaaatat atatttcaaa
     1441 attcaataaa taatttcaga cttaataaaa aaatatgcgt taattggtaa attttaaatt
     1501 acaaattagt tattttaaaa aataataacg ttagaaagca