Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab21


LOCUS       XM_017153504            1094 bp    mRNA    linear   INV 09-DEC-2024
            (Rab21), mRNA.
ACCESSION   XM_017153504
VERSION     XM_017153504.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153504.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1094
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1094
                     /gene="Rab21"
                     /note="RAS oncogene family member Rab21; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:108065503"
     CDS             146..814
                     /gene="Rab21"
                     /codon_start=1
                     /product="ras-related protein Rab-21"
                     /protein_id="XP_017008993.2"
                     /db_xref="GeneID:108065503"
                     /translation="MSARRTRSGPTLNFKAVLLGEGCVGKTSLVLRYMEDRFNTQHLS
                     TLQASFVTRKVSLEDGRRAQLNIWDTAGQERFHALGPIYYRGSDGALLVYDITDQDSF
                     QKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVAHEDALQYARTVGAEHMETSAKE
                     NEGVAELFDLLTHLMLEQLSQREPDGAPLRLEYPDTGGPSHSEDCEVSDHGDPTGQRS
                     CCGI"
     misc_feature    185..673
                     /gene="Rab21"
                     /note="Rab GTPase family 21 (Rab21); Region: Rab21;
                     cd04123"
                     /db_xref="CDD:133323"
     misc_feature    185..190
                     /gene="Rab21"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:133323"
     misc_feature    203..226
                     /gene="Rab21"
                     /note="G1 box; other site"
                     /db_xref="CDD:133323"
     misc_feature    order(209..211,218..229,257..259,275..280,524..529,
                     533..535,614..622)
                     /gene="Rab21"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133323"
     misc_feature    order(227..259,272..277)
                     /gene="Rab21"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:133323"
     misc_feature    order(257..259,272..298)
                     /gene="Rab21"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133323"
     misc_feature    order(272..274,284..307,329..331,335..337)
                     /gene="Rab21"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133323"
     misc_feature    278..280
                     /gene="Rab21"
                     /note="G2 box; other site"
                     /db_xref="CDD:133323"
     misc_feature    order(281..283,287..295,341..343,347..349,368..373,
                     380..382,392..394,398..409)
                     /gene="Rab21"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133323"
     misc_feature    order(281..286,290..292,347..352,371..373,377..379,
                     383..391)
                     /gene="Rab21"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133323"
     misc_feature    281..295
                     /gene="Rab21"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:133323"
     misc_feature    335..349
                     /gene="Rab21"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:133323"
     misc_feature    350..361
                     /gene="Rab21"
                     /note="G3 box; other site"
                     /db_xref="CDD:133323"
     misc_feature    order(359..361,365..397)
                     /gene="Rab21"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133323"
     misc_feature    368..385
                     /gene="Rab21"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:133323"
     misc_feature    392..406
                     /gene="Rab21"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:133323"
     misc_feature    419..436
                     /gene="Rab21"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:133323"
     misc_feature    503..517
                     /gene="Rab21"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:133323"
     misc_feature    524..535
                     /gene="Rab21"
                     /note="G4 box; other site"
                     /db_xref="CDD:133323"
     misc_feature    614..622
                     /gene="Rab21"
                     /note="G5 box; other site"
                     /db_xref="CDD:133323"
     misc_feature    662..673
                     /gene="Rab21"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:133323"
     polyA_site      1094
                     /gene="Rab21"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtgctggac gacagccaca ctggcggacg tataaaatat aatctaagtt ttgcattttc
       61 ctcttgtttt ttttttgttt tttcgtgtcc ccttctgaaa actgatgtgt gtacgggcag
      121 gaaagctagc aatcgggaac tcacaatgag cgcgcgcaga acgaggagcg gtcccacgct
      181 taatttcaag gcggtgctgc tgggcgaagg ttgtgtgggc aagacgtcgc tggtgctgcg
      241 ctacatggag gaccggttca atacccagca cctgagcacc ctgcaggcct ccttcgtgac
      301 gcgcaaggtg tccctggagg acgggaggag ggcccagttg aatatctggg acacggctgg
      361 gcaggagcgg ttccacgctc tggggcccat ctactaccga ggatctgatg gcgctctgct
      421 cgtctacgac ataaccgacc aggactcgtt ccagaaggtc aagtcctggg tgcgggagct
      481 ccggcaaatg cgcggcacag agattgccct gataatcgtg ggtaacaaga ctgatttgga
      541 ggaacagcgg gccgtggccc acgaggatgc cctgcaatat gcgcgcacag tgggcgccga
      601 gcatatggaa acatcggcca aggagaacga gggcgtggcc gagctctttg atctgctgac
      661 ccatctgatg ctggagcagc ttagccagcg ggaaccggac ggggctccgc tgcgcctcga
      721 gtatccggat acgggtggcc ccagtcactc cgaggattgc gaagtctctg atcacggcga
      781 tcctacgggc cagcgatcct gctgcggcat ttagccgtcc ccattgtgat agtaatcata
      841 attatatact agtaccctgt agccgaggtt cattttgtgt atatattgta tttacttata
      901 gcgcgtatgt ttctgttatc aaataacccc agtaccaaac tgaccccacg tatttttgtt
      961 gatcctcatt attgttgtcc aaattgctca gacatttccg tttcgtgttc tcggcatcta
     1021 gtttgtgtac aaaatttagt gtttgcccaa tcgaactttg tgtgcgtcta gcaataaatt
     1081 atgttgtact tgca