Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153504 1094 bp mRNA linear INV 09-DEC-2024 (Rab21), mRNA. ACCESSION XM_017153504 VERSION XM_017153504.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153504.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1094 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1094 /gene="Rab21" /note="RAS oncogene family member Rab21; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108065503" CDS 146..814 /gene="Rab21" /codon_start=1 /product="ras-related protein Rab-21" /protein_id="XP_017008993.2" /db_xref="GeneID:108065503" /translation="MSARRTRSGPTLNFKAVLLGEGCVGKTSLVLRYMEDRFNTQHLS TLQASFVTRKVSLEDGRRAQLNIWDTAGQERFHALGPIYYRGSDGALLVYDITDQDSF QKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVAHEDALQYARTVGAEHMETSAKE NEGVAELFDLLTHLMLEQLSQREPDGAPLRLEYPDTGGPSHSEDCEVSDHGDPTGQRS CCGI" misc_feature 185..673 /gene="Rab21" /note="Rab GTPase family 21 (Rab21); Region: Rab21; cd04123" /db_xref="CDD:133323" misc_feature 185..190 /gene="Rab21" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:133323" misc_feature 203..226 /gene="Rab21" /note="G1 box; other site" /db_xref="CDD:133323" misc_feature order(209..211,218..229,257..259,275..280,524..529, 533..535,614..622) /gene="Rab21" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133323" misc_feature order(227..259,272..277) /gene="Rab21" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:133323" misc_feature order(257..259,272..298) /gene="Rab21" /note="Switch I region; other site" /db_xref="CDD:133323" misc_feature order(272..274,284..307,329..331,335..337) /gene="Rab21" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133323" misc_feature 278..280 /gene="Rab21" /note="G2 box; other site" /db_xref="CDD:133323" misc_feature order(281..283,287..295,341..343,347..349,368..373, 380..382,392..394,398..409) /gene="Rab21" /note="putative effector interaction site [active]" /db_xref="CDD:133323" misc_feature order(281..286,290..292,347..352,371..373,377..379, 383..391) /gene="Rab21" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:133323" misc_feature 281..295 /gene="Rab21" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:133323" misc_feature 335..349 /gene="Rab21" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:133323" misc_feature 350..361 /gene="Rab21" /note="G3 box; other site" /db_xref="CDD:133323" misc_feature order(359..361,365..397) /gene="Rab21" /note="Switch II region; other site" /db_xref="CDD:133323" misc_feature 368..385 /gene="Rab21" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:133323" misc_feature 392..406 /gene="Rab21" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:133323" misc_feature 419..436 /gene="Rab21" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:133323" misc_feature 503..517 /gene="Rab21" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:133323" misc_feature 524..535 /gene="Rab21" /note="G4 box; other site" /db_xref="CDD:133323" misc_feature 614..622 /gene="Rab21" /note="G5 box; other site" /db_xref="CDD:133323" misc_feature 662..673 /gene="Rab21" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:133323" polyA_site 1094 /gene="Rab21" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtgctggac gacagccaca ctggcggacg tataaaatat aatctaagtt ttgcattttc 61 ctcttgtttt ttttttgttt tttcgtgtcc ccttctgaaa actgatgtgt gtacgggcag 121 gaaagctagc aatcgggaac tcacaatgag cgcgcgcaga acgaggagcg gtcccacgct 181 taatttcaag gcggtgctgc tgggcgaagg ttgtgtgggc aagacgtcgc tggtgctgcg 241 ctacatggag gaccggttca atacccagca cctgagcacc ctgcaggcct ccttcgtgac 301 gcgcaaggtg tccctggagg acgggaggag ggcccagttg aatatctggg acacggctgg 361 gcaggagcgg ttccacgctc tggggcccat ctactaccga ggatctgatg gcgctctgct 421 cgtctacgac ataaccgacc aggactcgtt ccagaaggtc aagtcctggg tgcgggagct 481 ccggcaaatg cgcggcacag agattgccct gataatcgtg ggtaacaaga ctgatttgga 541 ggaacagcgg gccgtggccc acgaggatgc cctgcaatat gcgcgcacag tgggcgccga 601 gcatatggaa acatcggcca aggagaacga gggcgtggcc gagctctttg atctgctgac 661 ccatctgatg ctggagcagc ttagccagcg ggaaccggac ggggctccgc tgcgcctcga 721 gtatccggat acgggtggcc ccagtcactc cgaggattgc gaagtctctg atcacggcga 781 tcctacgggc cagcgatcct gctgcggcat ttagccgtcc ccattgtgat agtaatcata 841 attatatact agtaccctgt agccgaggtt cattttgtgt atatattgta tttacttata 901 gcgcgtatgt ttctgttatc aaataacccc agtaccaaac tgaccccacg tatttttgtt 961 gatcctcatt attgttgtcc aaattgctca gacatttccg tttcgtgttc tcggcatcta 1021 gtttgtgtac aaaatttagt gtttgcccaa tcgaactttg tgtgcgtcta gcaataaatt 1081 atgttgtact tgca