Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153493 1112 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017153493 VERSION XM_017153493.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153493.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1112 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1112 /gene="LOC108065495" /note="protein THEM6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108065495" CDS 220..801 /gene="LOC108065495" /codon_start=1 /product="protein THEM6" /protein_id="XP_017008982.1" /db_xref="GeneID:108065495" /translation="MSWLVLLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTI YGLCTSQDVDIFIRHMNNARYLRELDFARFHFYALTGLYERIRERRGGAVQGASSVRY RRTIPIFHPYKIQTKLVWWDDKAIYLEQQFVTLSDGFVRAVAMSKQNITNCNVLEVLK TYPETAQRPEKPEELKLWLDAIELSSQKLRKDK" misc_feature 361..756 /gene="LOC108065495" /note="Thioesterase-like superfamily; Region: 4HBT_2; pfam13279" /db_xref="CDD:463826" ORIGIN 1 cagtctgcag tctacactct ccagtcttca gtctacagtc tacaatcttc agtcgtctgt 61 ggtcttgctt cgcctgcggt tgtgttgctg cgtaccgctc tacccgattc aaccgatttc 121 tacctttacc gctttcccgc tccgctggac ccgctcgtcc cgctgctagt tgccagctgc 181 aaattgggag taccaactta gccaaacttc aaagccgcga tgtcttggct agtcctgctg 241 ctgatcctgt acgtgatctg ggatgtcaac tacttcatcc gctgtgtgtt caccgtgttc 301 gcgggtcgcc tgttccagcg gaagcgcaag gtgacggaca cgacgacgat ctacgggctg 361 tgcacctcgc aggatgtgga catcttcatc cggcacatga acaatgcccg ctatctgcgg 421 gaactggact ttgcccgctt ccatttctac gccctcaccg gtctgtatga gcgcatccgg 481 gagcgacgag gtggggctgt ccagggtgcc agtagtgtgc gctaccgccg caccataccc 541 atcttccatc cgtacaagat ccagacgaag ctggtctggt gggacgacaa ggccatctac 601 ttggagcagc agttcgtcac cctctccgac ggcttcgtgc gggcggtggc catgtccaag 661 cagaacatca ccaactgcaa cgttctcgag gtcctgaaga cctatccgga gaccgcccag 721 cggccggaga agcccgagga gctcaagctc tggctggacg ccatcgaact ctccagccag 781 aagctgcgaa aggacaagtg agccgcctgc tgagccacta aattgatgaa tcttgcctca 841 ctcacttagt tgcgtaaccc attttttttg agtgcactgt ggaaaaatgt tagactgatt 901 ttttacactt taaatttgca taacaaatag aaaaactgta atatgcaatg taaataccat 961 tttctatata aaaccagaag tttcaaattc cagatcttaa actaaatacc ataaattcct 1021 tgaatttttc cacagtgcat taactataac gaacaatttg taataagata tcaccttaat 1081 agagtggccg agtggcttat taaatatagt tg