Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein THEM6 (LOC108065495),


LOCUS       XM_017153493            1112 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017153493
VERSION     XM_017153493.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153493.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1112
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1112
                     /gene="LOC108065495"
                     /note="protein THEM6; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108065495"
     CDS             220..801
                     /gene="LOC108065495"
                     /codon_start=1
                     /product="protein THEM6"
                     /protein_id="XP_017008982.1"
                     /db_xref="GeneID:108065495"
                     /translation="MSWLVLLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTI
                     YGLCTSQDVDIFIRHMNNARYLRELDFARFHFYALTGLYERIRERRGGAVQGASSVRY
                     RRTIPIFHPYKIQTKLVWWDDKAIYLEQQFVTLSDGFVRAVAMSKQNITNCNVLEVLK
                     TYPETAQRPEKPEELKLWLDAIELSSQKLRKDK"
     misc_feature    361..756
                     /gene="LOC108065495"
                     /note="Thioesterase-like superfamily; Region: 4HBT_2;
                     pfam13279"
                     /db_xref="CDD:463826"
ORIGIN      
        1 cagtctgcag tctacactct ccagtcttca gtctacagtc tacaatcttc agtcgtctgt
       61 ggtcttgctt cgcctgcggt tgtgttgctg cgtaccgctc tacccgattc aaccgatttc
      121 tacctttacc gctttcccgc tccgctggac ccgctcgtcc cgctgctagt tgccagctgc
      181 aaattgggag taccaactta gccaaacttc aaagccgcga tgtcttggct agtcctgctg
      241 ctgatcctgt acgtgatctg ggatgtcaac tacttcatcc gctgtgtgtt caccgtgttc
      301 gcgggtcgcc tgttccagcg gaagcgcaag gtgacggaca cgacgacgat ctacgggctg
      361 tgcacctcgc aggatgtgga catcttcatc cggcacatga acaatgcccg ctatctgcgg
      421 gaactggact ttgcccgctt ccatttctac gccctcaccg gtctgtatga gcgcatccgg
      481 gagcgacgag gtggggctgt ccagggtgcc agtagtgtgc gctaccgccg caccataccc
      541 atcttccatc cgtacaagat ccagacgaag ctggtctggt gggacgacaa ggccatctac
      601 ttggagcagc agttcgtcac cctctccgac ggcttcgtgc gggcggtggc catgtccaag
      661 cagaacatca ccaactgcaa cgttctcgag gtcctgaaga cctatccgga gaccgcccag
      721 cggccggaga agcccgagga gctcaagctc tggctggacg ccatcgaact ctccagccag
      781 aagctgcgaa aggacaagtg agccgcctgc tgagccacta aattgatgaa tcttgcctca
      841 ctcacttagt tgcgtaaccc attttttttg agtgcactgt ggaaaaatgt tagactgatt
      901 ttttacactt taaatttgca taacaaatag aaaaactgta atatgcaatg taaataccat
      961 tttctatata aaaccagaag tttcaaattc cagatcttaa actaaatacc ataaattcct
     1021 tgaatttttc cacagtgcat taactataac gaacaatttg taataagata tcaccttaat
     1081 agagtggccg agtggcttat taaatatagt tg