Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153483 687 bp mRNA linear INV 09-DEC-2024 Acp29AB-like (LOC108065485), mRNA. ACCESSION XM_017153483 VERSION XM_017153483.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..687 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..687 /gene="LOC108065485" /note="accessory gland protein Acp29AB-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:108065485" CDS 1..687 /gene="LOC108065485" /codon_start=1 /product="accessory gland protein Acp29AB-like" /protein_id="XP_017008972.1" /db_xref="GeneID:108065485" /translation="MLRLVVSLFVLNFFGPLSAFQDNGSFICQVTDAPSQCGAFCLAA LHPLFDDNQRSWAKLNQIDEKVEWLRTKLENQENSMQAKLDAQLQAIQKMLKDQNSAL AQSGDTRGRLQTQNLNGNQLLTPQNQPTLKIIDPRFELIGSTFFYIEKFIKKTWDEAA GTCREMGGSLAAFKTQEEITAIMPKLNKAYYWTGIKKKDGEFVSSASGKWNMALKWPS GEPNDDDNET" misc_feature 457..>681 /gene="LOC108065485" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" ORIGIN 1 atgctgagac tcgtggtctc cttgttcgtc cttaacttct ttggaccgtt gagcgccttc 61 caggacaatg gatccttcat ttgccaagtg accgacgcac cgagtcagtg tggcgccttt 121 tgcctggccg cactgcatcc gcttttcgac gataaccaaa gaagctgggc gaaactaaac 181 caaatcgatg aaaaagtgga atggctacgc accaaattgg aaaatcagga gaactccatg 241 caagccaaat tggatgccca acttcaggcg atacagaaaa tgctgaagga ccaaaactca 301 gcccttgctc aatctggtga cacgaggggt cgactacaaa ctcaaaacct aaatggaaac 361 caacttctga cgccgcagaa ccaaccaact ttgaagatca tcgatccaag atttgagctg 421 attggatcta cattttttta tatcgaaaaa tttattaaga aaacctggga tgaagctgca 481 ggaacatgtc gtgaaatggg cggctctttg gcggcattca aaacccaaga ggaaatcaca 541 gccataatgc caaaacttaa taaagcctat tactggactg gcatcaagaa gaaagatggc 601 gagttcgttt cttcggcctc tgggaagtgg aatatggctt taaagtggcc cagcggagag 661 cccaacgatg acgataatga aacataa