PREDICTED: Drosophila takahashii accessory gland protein

LOCUS       XM_017153482             855 bp    mRNA    linear   INV 09-DEC-2024
            Acp29AB-like (LOC108065484), mRNA.
ACCESSION   XM_017153482
VERSION     XM_017153482.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153482.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..855
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..855
                     /gene="LOC108065484"
                     /note="accessory gland protein Acp29AB-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:108065484"
     CDS             1..855
                     /gene="LOC108065484"
                     /codon_start=1
                     /product="accessory gland protein Acp29AB-like"
                     /protein_id="XP_017008971.2"
                     /db_xref="GeneID:108065484"
                     /translation="MLSFVPFIFVLNFIGPLSALQDNDSSICLLTDAPNQCGAFCLSA
                     LHPLIDDNFHSQVKLDRIEQGVESLKNASEGHFGSVNSQIKNEFQSLLTKMEISMLID
                     GQLLEVYKKLEARLNGTEGQLRMFESKMEAQLLELKNQLSAFQKTLLEIPSTIYYKIK
                     YPKFELIGSRYFYIEHYIKKTWDEAAETCREMGGYLAAFENPEELTAVMSKFFRWSYW
                     TGIKRLKEDGEYISTASGKPATVFKAPFSFGGSDIGGPCVLLRGVGMFEFPCNDEKYF
                     ICQSDNET"
     misc_feature    484..837
                     /gene="LOC108065484"
                     /note="C-type lectin (CTL) or carbohydrate-recognition
                     domain (CRD); Region: CLECT; smart00034"
                     /db_xref="CDD:214480"
     misc_feature    order(763..765,775..777,781..783,799..801,802..807,
                     814..822)
                     /gene="LOC108065484"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgagtt ttgtgccttt catcttcgtc ctgaatttca tcggtccttt gagcgccctc
       61 caggataatg attcttccat ctgcctactt accgatgctc ccaatcagtg tggagccttc
      121 tgcctgtccg cactgcatcc tcttatcgac gacaatttcc acagccaggt gaagctggat
      181 cggattgagc aaggagtcga atccctgaag aatgcttccg aaggacattt tggatcggtg
      241 aattcacaga tcaagaatga attccagtcg cttctcacca aaatggagat atccatgctg
      301 atagatggcc aacttctgga ggtatataaa aagctagagg cgagattaaa tggaacggag
      361 ggtcaactac ggatgttcga gtcgaaaatg gaggcccaac ttctggagct aaagaaccaa
      421 ctatcggcct ttcagaaaac ccttctcgaa atcccttcca caatttatta taagatcaag
      481 tatccgaaat ttgagcttat tggatctaga tatttttata tcgaacatta tattaagaaa
      541 acctgggatg aggctgcaga aacatgtcga gaaatgggcg gctatttggc ggctttcgaa
      601 aacccagagg aactcacggc cgtaatgtcg aagtttttta gatggagtta ctggactggc
      661 atcaagcgtt tgaaggaaga tggagagtac atatccacgg cctccgggaa gccagccacc
      721 gtttttaaag caccgttttc cttcggaggg tccgacattg gcggtccatg cgttctgcta
      781 cgtggagtcg ggatgtttga attcccttgt aatgatgaaa aatattttat ttgccaatca
      841 gataatgaaa cataa