Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii accessory gland protein


LOCUS       XM_017153480             861 bp    mRNA    linear   INV 09-DEC-2024
            Acp29AB-like (LOC108065481), mRNA.
ACCESSION   XM_017153480
VERSION     XM_017153480.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153480.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..861
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..861
                     /gene="LOC108065481"
                     /note="accessory gland protein Acp29AB-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 15 Proteins"
                     /db_xref="GeneID:108065481"
     CDS             1..861
                     /gene="LOC108065481"
                     /codon_start=1
                     /product="accessory gland protein Acp29AB-like"
                     /protein_id="XP_017008969.2"
                     /db_xref="GeneID:108065481"
                     /translation="MLRLIYFPMLLLIILVSQGSVAKSEENGRSTCLLQDPQNQCGDF
                     CLSKINPIIELVPETNSKLERIHGEQQSIQMKLLAVQSKLEISMQSKLDAQLLAVQKK
                     LEDQNTALFKSFEERFETKVEAQLKELQNKAENQLMALANQLSALQKTLFETLSTINS
                     KIIPPKFELIGSRHFYIENNIVQSWDKAAETCRAMGGYLAAFKTQEELAAIMPKLDSL
                     SWYWTGIKHLKEDGTFISTASGKPATIFRWKKGEPNNSGACVELDKWGMRDIRCSFGR
                     YFICQLDNET"
     misc_feature    172..>450
                     /gene="LOC108065481"
                     /note="Uncharacterized N-terminal coiled-coil domain of
                     peptidoglycan hydrolase CwlO [Function unknown]; Region:
                     CwlO1; COG3883"
                     /db_xref="CDD:443091"
     misc_feature    520..843
                     /gene="LOC108065481"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(781..783,787..789,796..798,802..813,820..828)
                     /gene="LOC108065481"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgaggc tgatatattt tccgatgctg ctccttatta tcctggtgtc tcaaggatct
       61 gttgcgaaat cagaggaaaa tgggcgatcc acttgcctgt tgcaggaccc acagaatcag
      121 tgtggcgact tctgccttag caagatcaat ccgattattg agttggttcc cgagaccaat
      181 tccaagttgg aaagaatcca cggcgagcag cagtccatcc agatgaagct cctggcagtt
      241 cagtccaagt tggagatttc tatgcaaagc aagctggatg cccaacttct ggcggttcag
      301 aaaaagctag aggaccaaaa tactgccctt tttaaatcct ttgaggagag attcgagacc
      361 aaagtagagg cccaactaaa ggagcttcaa aacaaagctg aaaaccaact tatggcgctg
      421 gcgaaccaac tatcggcctt acagaaaacc cttttcgaaa ccctttccac aatcaattcc
      481 aagatcatcc ctccaaagtt cgagctaatt ggctctagac atttttatat cgaaaataat
      541 attgtgcaat cctgggataa ggctgcagaa acatgtcgtg caatgggcgg ctatttggcg
      601 gctttcaaaa cccaagagga actcgcggcc ataatgccga aacttgatag tctgagctgg
      661 tactggactg gcatcaagca tttgaaggaa gatggcacgt tcatatccac ggcctccgga
      721 aagcctgcaa ccatttttag gtggaagaag ggagagccca acaatagcgg tgcatgcgtt
      781 gagctggata aatggggcat gcgtgatatc cgttgtagct ttggacgtta ttttatttgc
      841 caattagata atgaaaccta a