Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153480 861 bp mRNA linear INV 09-DEC-2024 Acp29AB-like (LOC108065481), mRNA. ACCESSION XM_017153480 VERSION XM_017153480.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017153480.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..861 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..861 /gene="LOC108065481" /note="accessory gland protein Acp29AB-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:108065481" CDS 1..861 /gene="LOC108065481" /codon_start=1 /product="accessory gland protein Acp29AB-like" /protein_id="XP_017008969.2" /db_xref="GeneID:108065481" /translation="MLRLIYFPMLLLIILVSQGSVAKSEENGRSTCLLQDPQNQCGDF CLSKINPIIELVPETNSKLERIHGEQQSIQMKLLAVQSKLEISMQSKLDAQLLAVQKK LEDQNTALFKSFEERFETKVEAQLKELQNKAENQLMALANQLSALQKTLFETLSTINS KIIPPKFELIGSRHFYIENNIVQSWDKAAETCRAMGGYLAAFKTQEELAAIMPKLDSL SWYWTGIKHLKEDGTFISTASGKPATIFRWKKGEPNNSGACVELDKWGMRDIRCSFGR YFICQLDNET" misc_feature 172..>450 /gene="LOC108065481" /note="Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function unknown]; Region: CwlO1; COG3883" /db_xref="CDD:443091" misc_feature 520..843 /gene="LOC108065481" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(781..783,787..789,796..798,802..813,820..828) /gene="LOC108065481" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 atgctgaggc tgatatattt tccgatgctg ctccttatta tcctggtgtc tcaaggatct 61 gttgcgaaat cagaggaaaa tgggcgatcc acttgcctgt tgcaggaccc acagaatcag 121 tgtggcgact tctgccttag caagatcaat ccgattattg agttggttcc cgagaccaat 181 tccaagttgg aaagaatcca cggcgagcag cagtccatcc agatgaagct cctggcagtt 241 cagtccaagt tggagatttc tatgcaaagc aagctggatg cccaacttct ggcggttcag 301 aaaaagctag aggaccaaaa tactgccctt tttaaatcct ttgaggagag attcgagacc 361 aaagtagagg cccaactaaa ggagcttcaa aacaaagctg aaaaccaact tatggcgctg 421 gcgaaccaac tatcggcctt acagaaaacc cttttcgaaa ccctttccac aatcaattcc 481 aagatcatcc ctccaaagtt cgagctaatt ggctctagac atttttatat cgaaaataat 541 attgtgcaat cctgggataa ggctgcagaa acatgtcgtg caatgggcgg ctatttggcg 601 gctttcaaaa cccaagagga actcgcggcc ataatgccga aacttgatag tctgagctgg 661 tactggactg gcatcaagca tttgaaggaa gatggcacgt tcatatccac ggcctccgga 721 aagcctgcaa ccatttttag gtggaagaag ggagagccca acaatagcgg tgcatgcgtt 781 gagctggata aatggggcat gcgtgatatc cgttgtagct ttggacgtta ttttatttgc 841 caattagata atgaaaccta a