Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RB1-inducible coiled-coil protein


LOCUS       XM_017153478            1233 bp    mRNA    linear   INV 09-DEC-2024
            1-like (LOC108065479), mRNA.
ACCESSION   XM_017153478
VERSION     XM_017153478.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153478.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1233
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1233
                     /gene="LOC108065479"
                     /note="RB1-inducible coiled-coil protein 1-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108065479"
     CDS             1..1233
                     /gene="LOC108065479"
                     /codon_start=1
                     /product="RB1-inducible coiled-coil protein 1-like"
                     /protein_id="XP_017008967.2"
                     /db_xref="GeneID:108065479"
                     /translation="MLKLTYLSLLLLVILVSQESVAKSQNNGRSTCLLQDPQNQCGDF
                     CLSKIHPMIELVPETNSKLKKVLGEQQSIQMKLVAVQSTVEAQRISMQNSLNDITTKE
                     EFGAKLGDTKEKLMAVIFELKNQLQLQSTKMEDQDTAMQTKLIGLNSELKSQLQYLQT
                     NLESLQRTITKNFAERLNVTEEQLLVSNSELKTQLKEMDTNVRDQDISMQTKLDAQLL
                     AVQKKLEDQNTALSESFEARLNGTEVKMEAQLKELQNKTENQLAVLENQLSALQKTLL
                     ETHSALYHKFFYPKFERYGSRYFYFEHTIRKPFDEAAAACRGMGGYLAAFKTQEELEA
                     ISIKPEVEIGYYWTGIKLNMYDEFISTASGKPASVFMWNLGEPDHDGECIAMVYGEMS
                     DFDCHHYNNFICQSDNEI"
     misc_feature    <370..>840
                     /gene="LOC108065479"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     misc_feature    886..1215
                     /gene="LOC108065479"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(1153..1155,1159..1161,1168..1170,1174..1185,
                     1192..1200)
                     /gene="LOC108065479"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgaagc tgacatattt atctttgctg ctccttgtta tcctggtgtc tcaagaatct
       61 gttgctaaat cacaaaataa tgggcgatcc acttgcctgt tgcaggaccc acaaaatcag
      121 tgtggcgact tctgccttag caagatccat ccgatgattg agttggttcc cgaaaccaat
      181 tccaaactga agaaggtcct cggcgagcag cagtccatcc agatgaagct cgtggcagtt
      241 cagtcgacgg tggaggccca aaggatctca atgcagaatt ccttgaacga catcaccacg
      301 aaagaagagt ttggggcgaa actcggcgac acgaaggaaa aactaatggc ggtgattttt
      361 gaattaaaaa accaacttca gttgcagagc accaaaatgg aggaccagga tacagcaatg
      421 caaaccaaac tgattgggtt aaattccgag ctcaaaagtc agctgcaata tcttcagacg
      481 aatctggagt ccctgcagag gaccatcaca aagaacttcg cggagcggtt aaatgtgaca
      541 gaagagcagc ttttggtttc gaattccgag ttaaagaccc aactaaagga aatggacaca
      601 aatgtaagag atcaggatat atccatgcaa accaaactgg atgcccaact tctggcggtt
      661 cagaaaaaac tggaggacca aaatacagct ctttccgaat cctttgaggc gagattaaac
      721 ggaacggagg taaaaatgga agcccaacta aaggagcttc aaaacaaaac tgagaaccaa
      781 cttgcggtgc tggagaacca actatcggcc ttgcagaaaa cccttctcga aacacattcc
      841 gctctctatc acaagttttt ctatcctaag tttgagcgtt atggctctcg atatttttat
      901 ttcgaacata caattagaaa accctttgat gaggctgcag cagcatgtcg aggaatgggc
      961 ggctatttgg cggctttcaa aacccaagag gaactcgaag ccataagtat aaagccagaa
     1021 gttgagattg gttattactg gactggcatc aagctcaata tgtatgatga gttcatatct
     1081 acggcctccg gaaagcctgc atccgttttt atgtggaact taggagagcc cgaccatgac
     1141 ggtgaatgca ttgctatggt ttacggggag atgagtgatt tcgattgtca tcattacaat
     1201 aattttattt gccaatcaga caatgaaata taa