Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153478 1233 bp mRNA linear INV 09-DEC-2024 1-like (LOC108065479), mRNA. ACCESSION XM_017153478 VERSION XM_017153478.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017153478.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1233 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1233 /gene="LOC108065479" /note="RB1-inducible coiled-coil protein 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065479" CDS 1..1233 /gene="LOC108065479" /codon_start=1 /product="RB1-inducible coiled-coil protein 1-like" /protein_id="XP_017008967.2" /db_xref="GeneID:108065479" /translation="MLKLTYLSLLLLVILVSQESVAKSQNNGRSTCLLQDPQNQCGDF CLSKIHPMIELVPETNSKLKKVLGEQQSIQMKLVAVQSTVEAQRISMQNSLNDITTKE EFGAKLGDTKEKLMAVIFELKNQLQLQSTKMEDQDTAMQTKLIGLNSELKSQLQYLQT NLESLQRTITKNFAERLNVTEEQLLVSNSELKTQLKEMDTNVRDQDISMQTKLDAQLL AVQKKLEDQNTALSESFEARLNGTEVKMEAQLKELQNKTENQLAVLENQLSALQKTLL ETHSALYHKFFYPKFERYGSRYFYFEHTIRKPFDEAAAACRGMGGYLAAFKTQEELEA ISIKPEVEIGYYWTGIKLNMYDEFISTASGKPASVFMWNLGEPDHDGECIAMVYGEMS DFDCHHYNNFICQSDNEI" misc_feature <370..>840 /gene="LOC108065479" /note="chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168" /db_xref="CDD:274008" misc_feature 886..1215 /gene="LOC108065479" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(1153..1155,1159..1161,1168..1170,1174..1185, 1192..1200) /gene="LOC108065479" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 atgctgaagc tgacatattt atctttgctg ctccttgtta tcctggtgtc tcaagaatct 61 gttgctaaat cacaaaataa tgggcgatcc acttgcctgt tgcaggaccc acaaaatcag 121 tgtggcgact tctgccttag caagatccat ccgatgattg agttggttcc cgaaaccaat 181 tccaaactga agaaggtcct cggcgagcag cagtccatcc agatgaagct cgtggcagtt 241 cagtcgacgg tggaggccca aaggatctca atgcagaatt ccttgaacga catcaccacg 301 aaagaagagt ttggggcgaa actcggcgac acgaaggaaa aactaatggc ggtgattttt 361 gaattaaaaa accaacttca gttgcagagc accaaaatgg aggaccagga tacagcaatg 421 caaaccaaac tgattgggtt aaattccgag ctcaaaagtc agctgcaata tcttcagacg 481 aatctggagt ccctgcagag gaccatcaca aagaacttcg cggagcggtt aaatgtgaca 541 gaagagcagc ttttggtttc gaattccgag ttaaagaccc aactaaagga aatggacaca 601 aatgtaagag atcaggatat atccatgcaa accaaactgg atgcccaact tctggcggtt 661 cagaaaaaac tggaggacca aaatacagct ctttccgaat cctttgaggc gagattaaac 721 ggaacggagg taaaaatgga agcccaacta aaggagcttc aaaacaaaac tgagaaccaa 781 cttgcggtgc tggagaacca actatcggcc ttgcagaaaa cccttctcga aacacattcc 841 gctctctatc acaagttttt ctatcctaag tttgagcgtt atggctctcg atatttttat 901 ttcgaacata caattagaaa accctttgat gaggctgcag cagcatgtcg aggaatgggc 961 ggctatttgg cggctttcaa aacccaagag gaactcgaag ccataagtat aaagccagaa 1021 gttgagattg gttattactg gactggcatc aagctcaata tgtatgatga gttcatatct 1081 acggcctccg gaaagcctgc atccgttttt atgtggaact taggagagcc cgaccatgac 1141 ggtgaatgca ttgctatggt ttacggggag atgagtgatt tcgattgtca tcattacaat 1201 aattttattt gccaatcaga caatgaaata taa