Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153471 904 bp mRNA linear INV 09-DEC-2024 (LOC108065473), transcript variant X2, mRNA. ACCESSION XM_017153471 VERSION XM_017153471.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153471.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..904 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..904 /gene="LOC108065473" /note="E3 ubiquitin-protein ligase Kcmf1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065473" CDS 101..727 /gene="LOC108065473" /codon_start=1 /product="E3 ubiquitin-protein ligase Kcmf1 isoform X2" /protein_id="XP_017008960.2" /db_xref="GeneID:108065473" /translation="MSLHWDINCDGCGTPRLLLYRFKCLRCPDYDLCAECHEDGITGG DHERGHPFQCLLDRAARELHFGGGTIPDLCADSFTCPLCSKVGLSAGQLMDHCQAKHH LMRTPVICPLCVAVPSSHPHMVTNLANHLALWHPSSILRDQESDPESPESPLPHFPWR SFSGMGTGRATHHRLPSPQMPQVRFLVPRGTPPLATSEDLSDEEIVEM" misc_feature 119..265 /gene="LOC108065473" /note="Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel...; Region: ZZ_PCMF_like; cd02338" /db_xref="CDD:239078" misc_feature order(125..127,134..136,170..172,179..181,197..199, 206..208,236..238,248..250) /gene="LOC108065473" /note="Zinc-binding sites [ion binding]; other site" /db_xref="CDD:239078" misc_feature order(125..127,134..136,197..199,206..208) /gene="LOC108065473" /note="zinc cluster 1 [ion binding]; other site" /db_xref="CDD:239078" misc_feature order(128..130,161..163,167..169,185..187,191..193) /gene="LOC108065473" /note="putative charged binding surface [active]" /db_xref="CDD:239078" misc_feature order(164..166,209..211,254..256,263..265) /gene="LOC108065473" /note="putative hydrophobic binding surface [active]" /db_xref="CDD:239078" misc_feature order(170..172,179..181,236..238,248..250) /gene="LOC108065473" /note="zinc cluster 2 [ion binding]; other site" /db_xref="CDD:239078" misc_feature 326..505 /gene="LOC108065473" /note="Drought induced 19 protein (Di19), zinc-binding; Region: zf-Di19; pfam05605" /db_xref="CDD:428539" ORIGIN 1 taagtcatgg gctgtcaaaa acaattttat tttttgtaat tacgtttttt ttaattactg 61 tgagtcgccg acggggatcc ttgaccgcca ggactcggct atgtcgctcc actgggacat 121 caactgcgat ggctgcggga cgccgaggct gctcctctac cgcttcaagt gcctgcgctg 181 cccggattac gacctgtgcg ccgagtgcca cgaggacgga atcaccggcg gcgatcacga 241 gcggggtcac cccttccagt gcctcctgga ccgcgccgcc cgtgagctgc actttggggg 301 cgggacgatt ccggatctgt gcgccgacag cttcacctgt ccgctgtgct ccaaggtggg 361 tctgtcggcc gggcagttga tggaccactg ccaggcgaag caccacctga tgcgcacccc 421 cgtcatttgc cccctctgcg tggcggtgcc ttcctcgcat ccgcacatgg tcaccaacct 481 ggccaaccac ctggccctct ggcatccgtc gagcattttg cgggatcagg agtctgaccc 541 tgagtccccg gaatccccgc tgccccactt cccatggcgc tcgttctctg gaatgggaac 601 tggaagggcc acccaccacc gtctgcccag cccacaaatg ccgcaggtgc gcttccttgt 661 gcccaggggc acgcccccct tggccacgtc cgaggatctc agcgacgagg agatcgttga 721 gatgtgagtc cggaaaatta aattaaaaat aataaatcca agaaaataat caggaaaatt 781 agtatacgga ttcttggtac aaatataaat ttttgcttat gttatcttct tgttacttgg 841 ccaaaaaaca gtatcaaaaa tacaatacac tgttttaagt agccaacaca gcaaataaat 901 tgat