Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii E3 ubiquitin-protein ligase Kcmf1


LOCUS       XM_017153471             904 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065473), transcript variant X2, mRNA.
ACCESSION   XM_017153471
VERSION     XM_017153471.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153471.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..904
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..904
                     /gene="LOC108065473"
                     /note="E3 ubiquitin-protein ligase Kcmf1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108065473"
     CDS             101..727
                     /gene="LOC108065473"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase Kcmf1 isoform X2"
                     /protein_id="XP_017008960.2"
                     /db_xref="GeneID:108065473"
                     /translation="MSLHWDINCDGCGTPRLLLYRFKCLRCPDYDLCAECHEDGITGG
                     DHERGHPFQCLLDRAARELHFGGGTIPDLCADSFTCPLCSKVGLSAGQLMDHCQAKHH
                     LMRTPVICPLCVAVPSSHPHMVTNLANHLALWHPSSILRDQESDPESPESPLPHFPWR
                     SFSGMGTGRATHHRLPSPQMPQVRFLVPRGTPPLATSEDLSDEEIVEM"
     misc_feature    119..265
                     /gene="LOC108065473"
                     /note="Zinc finger, ZZ type. Zinc finger present in
                     potassium channel modulatory factor (PCMF) 1 and related
                     proteins. The ZZ motif coordinates two zinc ions and most
                     likely participates in ligand binding or molecular
                     scaffolding. Human potassium channel...; Region:
                     ZZ_PCMF_like; cd02338"
                     /db_xref="CDD:239078"
     misc_feature    order(125..127,134..136,170..172,179..181,197..199,
                     206..208,236..238,248..250)
                     /gene="LOC108065473"
                     /note="Zinc-binding sites [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    order(125..127,134..136,197..199,206..208)
                     /gene="LOC108065473"
                     /note="zinc cluster 1 [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    order(128..130,161..163,167..169,185..187,191..193)
                     /gene="LOC108065473"
                     /note="putative charged binding surface [active]"
                     /db_xref="CDD:239078"
     misc_feature    order(164..166,209..211,254..256,263..265)
                     /gene="LOC108065473"
                     /note="putative hydrophobic binding surface [active]"
                     /db_xref="CDD:239078"
     misc_feature    order(170..172,179..181,236..238,248..250)
                     /gene="LOC108065473"
                     /note="zinc cluster 2 [ion binding]; other site"
                     /db_xref="CDD:239078"
     misc_feature    326..505
                     /gene="LOC108065473"
                     /note="Drought induced 19 protein (Di19), zinc-binding;
                     Region: zf-Di19; pfam05605"
                     /db_xref="CDD:428539"
ORIGIN      
        1 taagtcatgg gctgtcaaaa acaattttat tttttgtaat tacgtttttt ttaattactg
       61 tgagtcgccg acggggatcc ttgaccgcca ggactcggct atgtcgctcc actgggacat
      121 caactgcgat ggctgcggga cgccgaggct gctcctctac cgcttcaagt gcctgcgctg
      181 cccggattac gacctgtgcg ccgagtgcca cgaggacgga atcaccggcg gcgatcacga
      241 gcggggtcac cccttccagt gcctcctgga ccgcgccgcc cgtgagctgc actttggggg
      301 cgggacgatt ccggatctgt gcgccgacag cttcacctgt ccgctgtgct ccaaggtggg
      361 tctgtcggcc gggcagttga tggaccactg ccaggcgaag caccacctga tgcgcacccc
      421 cgtcatttgc cccctctgcg tggcggtgcc ttcctcgcat ccgcacatgg tcaccaacct
      481 ggccaaccac ctggccctct ggcatccgtc gagcattttg cgggatcagg agtctgaccc
      541 tgagtccccg gaatccccgc tgccccactt cccatggcgc tcgttctctg gaatgggaac
      601 tggaagggcc acccaccacc gtctgcccag cccacaaatg ccgcaggtgc gcttccttgt
      661 gcccaggggc acgcccccct tggccacgtc cgaggatctc agcgacgagg agatcgttga
      721 gatgtgagtc cggaaaatta aattaaaaat aataaatcca agaaaataat caggaaaatt
      781 agtatacgga ttcttggtac aaatataaat ttttgcttat gttatcttct tgttacttgg
      841 ccaaaaaaca gtatcaaaaa tacaatacac tgttttaagt agccaacaca gcaaataaat
      901 tgat