PREDICTED: Drosophila takahashii C-type lectin 37Db-like

LOCUS       XM_017153470             498 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065471), mRNA.
ACCESSION   XM_017153470
VERSION     XM_017153470.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153470.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..498
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..498
                     /gene="LOC108065471"
                     /note="C-type lectin 37Db-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 27
                     Proteins"
                     /db_xref="GeneID:108065471"
     CDS             1..498
                     /gene="LOC108065471"
                     /codon_start=1
                     /product="C-type lectin 37Db-like"
                     /protein_id="XP_017008959.2"
                     /db_xref="GeneID:108065471"
                     /translation="MNAQLKELQNKSEIQILALENQLSAFQKTLLETLSTINNKIIPP
                     KFELILSRYFYIEHDYKKTWDEAAEACRGTGGYLAAFKTQEELAAIMQKLKKRVWYWT
                     GVRHSKEGGKFISTASGKPATVFKWFEGEPRNDGACVFLDDLGMRDLNCSSERSFICQ
                     LDNET"
     misc_feature    157..480
                     /gene="LOC108065471"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(418..420,424..426,433..435,439..450,457..465)
                     /gene="LOC108065471"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgaatgccc aactaaagga gcttcaaaac aaaagtgaaa tccaaattct ggcgctagag
       61 aaccaactat cggcctttca gaaaaccctt ctcgaaaccc tttccacaat caataacaag
      121 atcatccctc cgaagttcga gcttatttta tctagatatt tttatatcga acatgattat
      181 aagaaaacct gggatgaggc tgcagaagca tgtcgtggaa cgggcggcta tttggcggct
      241 tttaaaaccc aagaggaact ggcagccata atgcagaaac tcaagaaacg ggtttggtac
      301 tggactggcg ttaggcattc gaaggaaggt ggcaagttca tatctacggc ctccgggaag
      361 cctgctaccg tttttaagtg gttcgaagga gagcccagaa atgacggtgc atgcgttttt
      421 ctagatgact tggggatgcg tgatctcaat tgcagctctg aacgtagttt tatttgccaa
      481 ttagataacg aaacataa