PREDICTED: Drosophila takahashii C-type lectin 37Db-like

LOCUS       XM_017153468             492 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065469), mRNA.
ACCESSION   XM_017153468
VERSION     XM_017153468.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153468.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..492
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..492
                     /gene="LOC108065469"
                     /note="C-type lectin 37Db-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 21
                     Proteins"
                     /db_xref="GeneID:108065469"
     CDS             1..492
                     /gene="LOC108065469"
                     /codon_start=1
                     /product="C-type lectin 37Db-like"
                     /protein_id="XP_017008957.2"
                     /db_xref="GeneID:108065469"
                     /translation="MLSTVPFVIVLTFLGQLSADQDNGSLISETHSTMHNQKIIPPKF
                     ELIGSRYFYIELSSPETWDKSAEICRGMGGYLAAFKTQEEIAAITPKLYYIVWFWTGI
                     KHSKEDGKFISTASGKPATVFKWREGEPSNSGDCVYLGDLGMGVFNCSDTSYFICQSD
                     NET"
     misc_feature    145..474
                     /gene="LOC108065469"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(400..402,412..414,418..420,436..444,451..459)
                     /gene="LOC108065469"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgagca ccgtgccttt cgtgatcgtc ctgactttct tgggacagtt gagcgccgac
       61 caggataatg gttctttaat ctccgaaacg cattccacaa tgcataacca gaagatcatc
      121 ccaccgaagt tcgagctaat tgggtccaga tatttttata tcgaattaag tagtccggaa
      181 acctgggata agtccgcaga aatatgtcgt ggaatgggcg gctatttggc ggctttcaaa
      241 actcaagagg aaatcgcagc cataacgccg aaactttatt atattgtctg gttctggact
      301 ggcataaagc attcgaagga agatggaaag ttcatatcta cggcctccgg gaagcctgct
      361 accgtgttta agtggaggga gggagagccg agcaatagcg gtgattgcgt ttatcttggg
      421 gacttgggga tgggtgtttt caattgtagt gatacaagtt attttatttg ccaatcggat
      481 aatgaaacat aa