Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017153461            1011 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065463), mRNA.
ACCESSION   XM_017153461
VERSION     XM_017153461.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017153461.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1011
                     /gene="LOC108065463"
                     /note="uncharacterized LOC108065463; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:108065463"
     CDS             1..1011
                     /gene="LOC108065463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017008950.2"
                     /db_xref="GeneID:108065463"
                     /translation="MLRLAQFLLSLLVLDLQGSLGDTQDNNRTVCLLNDPPNQCGQFC
                     LTTLQPMTDLISEINAKLNGIQGAQQSIQIKLAAVESGLEDQRTQIDRIPTKEDFESR
                     LNETEAQLMEVKSEMKDQFDLLQIRLEDQSEAPREPSLNETENQLVAVNFEDLLKTGL
                     TEVLTKIQEYQEAAQTKLEGQLQTLETKLQTLLENQRAYFQKTVLETLERVSLSIPPN
                     FEKIGHRYFYIENSTRLDFYSAETRCRQLGGYLAAIQNQEELSALTAKLDKDTKYWLG
                     IKGSEWEFVSVASKATATFLKFAIQEGSDYFDGVYLFNGEMYKPYDLDDLYFICQADN
                     KV"
     misc_feature    <151..>636
                     /gene="LOC108065463"
                     /note="Coiled-coil domain-containing protein 158; Region:
                     CCDC158; pfam15921"
                     /db_xref="CDD:464943"
     misc_feature    670..993
                     /gene="LOC108065463"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(925..927,931..933,937..939,955..957,961..972,
                     973..978)
                     /gene="LOC108065463"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgaggc tggcccaatt cctcctgagc ctccttgtcc tggatttgca aggatcattg
       61 ggggatactc aggacaataa ccgaaccgtt tgtctactaa acgatcctcc taatcaatgt
      121 gggcagttct gccttaccac cctccaaccg atgaccgatc tgatttccga aatcaatgca
      181 aagttgaatg gaatccaagg ggcacagcag tctatacaga taaaacttgc ggcggtggaa
      241 tctggactgg aggaccaaag gacgcaaatt gataggattc ccacgaaaga ggacttcgag
      301 tcaagactta atgaaacaga agcccaactt atggaggtaa aatccgaaat gaaagaccaa
      361 tttgatttgc tgcagatcag gctggaagac cagagtgaag ctcccagaga acccagcctg
      421 aatgaaacag aaaatcaact tgtggctgtc aatttcgaag atcttctcaa gactggactc
      481 actgaagttc taacaaaaat acaagagtac caggaagccg cccaaaccaa gctggaaggt
      541 caactgcaga cattggagac caaattgcag actcttctag aaaaccagcg agcttatttt
      601 caaaaaaccg ttctcgaaac gctcgagaga gtctctttaa gcatcccgcc gaactttgaa
      661 aaaatcggcc ataggtactt ttatatagaa aatagtacta ggcttgattt ttattcggca
      721 gaaaccagat gtcgtcagtt gggaggttac ctggcggcga tccaaaacca agaagagctg
      781 agtgccctaa cagcaaaact ggataaagat accaaatact ggcttggcat taagggttcg
      841 gaatgggaat tcgtgtctgt tgcctctaag gccacagcta cgtttttgaa gtttgcgatt
      901 caagagggtt cagattattt cgatggggtc tatctattca atggagaaat gtataagcct
      961 tatgatttag atgaccttta tttcatttgc caagcagata acaaagtata g