Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017153457             622 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065457), mRNA.
ACCESSION   XM_017153457
VERSION     XM_017153457.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153457.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..622
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..622
                     /gene="LOC108065457"
                     /note="uncharacterized LOC108065457; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108065457"
     CDS             121..570
                     /gene="LOC108065457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017008946.2"
                     /db_xref="GeneID:108065457"
                     /translation="MSSAEIEEVIGQNPNLQNEYNEVEEPGNPDEDSHPSDSGRKSPT
                     ELDLPGTSYKKIAFDSLGIQDALDDQVAAFELESEQPGALEPETIQPNDARPPTPENF
                     DKEDEDTKDTLSEASLPTPEESNDEEEGGDNGPPSKKLKLLAAASSL"
ORIGIN      
        1 gtcaaatcca aatgtcagtt tgtggagctc agcccaacat aaattcagtt cattgaattt
       61 cagtttgtca ttcagatcag cattttactg catagaagaa agcaactaac tttttcagct
      121 atgtcgtccg cagagattga ggaagttatt ggacagaatc ctaacttgca gaacgaatac
      181 aatgaagtag aagaacctgg caatccagac gaggatagcc acccatctga ttccgggagg
      241 aagagcccaa ccgagttaga cctaccagga acctcctaca aaaagatcgc cttcgattca
      301 cttggcattc aggatgcttt ggatgaccaa gtcgccgctt ttgagctgga gtcagagcaa
      361 ccaggggctc ttgaacccga aaccattcaa cctaacgatg cccgtcctcc aaccccggag
      421 aacttcgaca aagaggatga ggacaccaag gacaccctat ctgaagccag tctcccaacc
      481 ccagaggagt ccaacgatga agaagaagga ggagacaacg gccccccttc gaagaaatta
      541 aaacttctag cagcagctag ttctttataa tttcattatt gttcccatgc acacggttct
      601 atataatata aactgttttt gt