Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153457 622 bp mRNA linear INV 09-DEC-2024 (LOC108065457), mRNA. ACCESSION XM_017153457 VERSION XM_017153457.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153457.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..622 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..622 /gene="LOC108065457" /note="uncharacterized LOC108065457; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108065457" CDS 121..570 /gene="LOC108065457" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017008946.2" /db_xref="GeneID:108065457" /translation="MSSAEIEEVIGQNPNLQNEYNEVEEPGNPDEDSHPSDSGRKSPT ELDLPGTSYKKIAFDSLGIQDALDDQVAAFELESEQPGALEPETIQPNDARPPTPENF DKEDEDTKDTLSEASLPTPEESNDEEEGGDNGPPSKKLKLLAAASSL" ORIGIN 1 gtcaaatcca aatgtcagtt tgtggagctc agcccaacat aaattcagtt cattgaattt 61 cagtttgtca ttcagatcag cattttactg catagaagaa agcaactaac tttttcagct 121 atgtcgtccg cagagattga ggaagttatt ggacagaatc ctaacttgca gaacgaatac 181 aatgaagtag aagaacctgg caatccagac gaggatagcc acccatctga ttccgggagg 241 aagagcccaa ccgagttaga cctaccagga acctcctaca aaaagatcgc cttcgattca 301 cttggcattc aggatgcttt ggatgaccaa gtcgccgctt ttgagctgga gtcagagcaa 361 ccaggggctc ttgaacccga aaccattcaa cctaacgatg cccgtcctcc aaccccggag 421 aacttcgaca aagaggatga ggacaccaag gacaccctat ctgaagccag tctcccaacc 481 ccagaggagt ccaacgatga agaagaagga ggagacaacg gccccccttc gaagaaatta 541 aaacttctag cagcagctag ttctttataa tttcattatt gttcccatgc acacggttct 601 atataatata aactgttttt gt