Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii


LOCUS       XM_017151798             866 bp    mRNA    linear   INV 09-DEC-2024
            Coiled-coil-helix-coiled-coil-helix domain containing 2 (Chchd2),
            mRNA.
ACCESSION   XM_017151798
VERSION     XM_017151798.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151798.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..866
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..866
                     /gene="Chchd2"
                     /note="Coiled-coil-helix-coiled-coil-helix domain
                     containing 2; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:108064306"
     CDS             122..634
                     /gene="Chchd2"
                     /codon_start=1
                     /product="coiled-coil-helix-coiled-coil-helix
                     domain-containing protein 2"
                     /protein_id="XP_017007287.1"
                     /db_xref="GeneID:108064306"
                     /translation="MVRRGRSASPPPSTRRSAPVQARAPAPAPAAAAPVPARAAAPPP
                     PPAPVSAPPSAVGMPAPQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKE
                     AAAPAAAAPAPQQQQPYYAQQQQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEAL
                     RQCKQSHHLQ"
     misc_feature    518..616
                     /gene="Chchd2"
                     /note="CHCH domain; Region: CHCH; pfam06747"
                     /db_xref="CDD:429096"
     polyA_site      866
                     /gene="Chchd2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaactttcca attgggatta tttcggaatt tcagttacca gctcgtcatc aaaacagcaa
       61 gaactgttaa atttttgcgt gaaacaacca agttagaaga caacaaatta aaacaaacaa
      121 aatggttcgc cgtggacgtt cagccagccc cccgccctcc actcgtcgct ccgcacctgt
      181 gcaggcccga gcccccgccc cggcacccgc cgccgccgcc cctgtgccgg cccgtgctgc
      241 tgcaccgccc ccaccgccgg cgcccgtgag cgctccgccc agcgccgtcg gcatgccggc
      301 cccccagcag ccctcgatgt tccagcagat ggccgccacc gcgggaggcg tggccgttgg
      361 ctcggccatt ggacacacgg tgggtcacgg gctcacctcg ctgttcagcg gatccgggga
      421 caaggaggca gctgctccgg cggccgcagc tccggctccc cagcagcagc agccctacta
      481 cgcccagcag cagcagccca acgagccgca gggagcctgc gcctgggagc tcaagcagtt
      541 catccagtgc gcccagggac aggcggatct gaccctctgc gagggattca acgaggcgct
      601 gcggcagtgc aagcagagcc accatctaca gtagatgaaa ccccctcccc ccggattaat
      661 ggatgatgat caccagccat ccaccgaccc cttcgtttag ttcttaattg tttaattgca
      721 agcatctgaa agagagcatt gtttaattgt agtgcaaaat gaaatgttga atagaaaatc
      781 ccattggcag cccaaactac gtacatcctt tccccttaaa aaaaaaaaaa accctgggct
      841 gtcagtgcgg gccaaaacaa aacaaa