Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151798 866 bp mRNA linear INV 09-DEC-2024 Coiled-coil-helix-coiled-coil-helix domain containing 2 (Chchd2), mRNA. ACCESSION XM_017151798 VERSION XM_017151798.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151798.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..866 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..866 /gene="Chchd2" /note="Coiled-coil-helix-coiled-coil-helix domain containing 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108064306" CDS 122..634 /gene="Chchd2" /codon_start=1 /product="coiled-coil-helix-coiled-coil-helix domain-containing protein 2" /protein_id="XP_017007287.1" /db_xref="GeneID:108064306" /translation="MVRRGRSASPPPSTRRSAPVQARAPAPAPAAAAPVPARAAAPPP PPAPVSAPPSAVGMPAPQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKE AAAPAAAAPAPQQQQPYYAQQQQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEAL RQCKQSHHLQ" misc_feature 518..616 /gene="Chchd2" /note="CHCH domain; Region: CHCH; pfam06747" /db_xref="CDD:429096" polyA_site 866 /gene="Chchd2" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaactttcca attgggatta tttcggaatt tcagttacca gctcgtcatc aaaacagcaa 61 gaactgttaa atttttgcgt gaaacaacca agttagaaga caacaaatta aaacaaacaa 121 aatggttcgc cgtggacgtt cagccagccc cccgccctcc actcgtcgct ccgcacctgt 181 gcaggcccga gcccccgccc cggcacccgc cgccgccgcc cctgtgccgg cccgtgctgc 241 tgcaccgccc ccaccgccgg cgcccgtgag cgctccgccc agcgccgtcg gcatgccggc 301 cccccagcag ccctcgatgt tccagcagat ggccgccacc gcgggaggcg tggccgttgg 361 ctcggccatt ggacacacgg tgggtcacgg gctcacctcg ctgttcagcg gatccgggga 421 caaggaggca gctgctccgg cggccgcagc tccggctccc cagcagcagc agccctacta 481 cgcccagcag cagcagccca acgagccgca gggagcctgc gcctgggagc tcaagcagtt 541 catccagtgc gcccagggac aggcggatct gaccctctgc gagggattca acgaggcgct 601 gcggcagtgc aagcagagcc accatctaca gtagatgaaa ccccctcccc ccggattaat 661 ggatgatgat caccagccat ccaccgaccc cttcgtttag ttcttaattg tttaattgca 721 agcatctgaa agagagcatt gtttaattgt agtgcaaaat gaaatgttga atagaaaatc 781 ccattggcag cccaaactac gtacatcctt tccccttaaa aaaaaaaaaa accctgggct 841 gtcagtgcgg gccaaaacaa aacaaa