PREDICTED: Drosophila takahashii ribosomal protein S5a (RpS5a),

LOCUS       XM_017151707             898 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017151707
VERSION     XM_017151707.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151707.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..898
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..898
                     /gene="RpS5a"
                     /note="ribosomal protein S5a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:108064272"
     CDS             93..779
                     /gene="RpS5a"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS7A"
                     /protein_id="XP_017007196.1"
                     /db_xref="GeneID:108064272"
                     /translation="MAEVAENVVETFEEPAAPMEAEVAETILETNVVATTELPEIKLF
                     GRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTCSLMM
                     KGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPREDSTRIGRAGTVRR
                     QAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKD
                     ELERVAKSNR"
     misc_feature    216..776
                     /gene="RpS5a"
                     /note="Eukaryota homolog of Ribosomal Protein S7; Region:
                     uS7_Eukaryote; cd14867"
                     /db_xref="CDD:271246"
     misc_feature    order(216..218,303..311,315..326,423..425,435..437)
                     /gene="RpS5a"
                     /note="S9 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271246"
     misc_feature    order(315..317,321..323,333..344,351..353,375..377,
                     384..386,390..404,414..428,435..437,555..563,567..569,
                     597..599,618..620,639..641,648..650,666..671)
                     /gene="RpS5a"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:271246"
     misc_feature    order(447..449,456..461,468..470,666..668,672..677)
                     /gene="RpS5a"
                     /note="S25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271246"
     misc_feature    order(552..554,561..563,567..569,774..776)
                     /gene="RpS5a"
                     /note="S11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271246"
     polyA_site      898
                     /gene="RpS5a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttctggcgtt gccgcacact gccccaacat gttctttttc aggcgtttgc ctttgcgctg
       61 acatcgtatc tcgatttctt ctgtgaccaa acatggccga agtagctgaa aacgtggtgg
      121 agaccttcga ggagccagcg gcacctatgg aagccgaggt cgccgagacg atcctggaga
      181 cgaatgtggt ggccaccacc gagctgccgg agatcaaact gttcggccgc tggtcctgcg
      241 acgatgtgac cgtcaacgac atctcgctgc aggattacat ctcggtgaag gagaagttcg
      301 cccgctacct tccccactcc gccggccgct atgccgccaa gcgcttccgc aaggcccagt
      361 gccccattgt ggagcgcctg acctgctccc tgatgatgaa gggccgcaac aacggcaaga
      421 agctgatggc ctgccgcatc gtcaagcact cgttcgagat catccatctg ctcaccgggg
      481 agaaccctct gcagatcctg gtcagcgcga tcatcaactc gggaccccgt gaggactcca
      541 cccgtattgg acgtgccggt accgtccgtc gccaggctgt ggatgtgtcg cccctgcgtc
      601 gcgtcaacca ggccatctgg ctgctgtgca ctggagctcg tgaggctgcc ttcaggaaca
      661 tcaagaccat cgctgagtgc ctggctgatg agctgatcaa cgctgccaag ggttcttcca
      721 actcgtacgc catcaagaag aaggatgagt tggagcgtgt ggccaagtcc aaccgttaag
      781 gagacatcat caccagcaaa aacaaacttc tgtgtctgtt tttttttata caaataacgt
      841 gtgtacactg cgaaatgata cactaaattt aaaataaaca acaagatgaa aaatccaa