Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151510 817 bp mRNA linear INV 09-DEC-2024 (LOC108064130), mRNA. ACCESSION XM_017151510 VERSION XM_017151510.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151510.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..817 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..817 /gene="LOC108064130" /note="keratin-associated protein 21-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108064130" CDS 72..707 /gene="LOC108064130" /codon_start=1 /product="keratin-associated protein 21-1" /protein_id="XP_017006999.2" /db_xref="GeneID:108064130" /translation="MKFYLALAAIVVVMASAEATFGKLNLLLGGASTAGYGSGYAGYG SGYGSGYGYGSGYGSGYGSGYGYAPENVVKVIKVSVVPGGGVGGGYGGGYSGGYGGGY SGGYSGGFVGAAPAISTSAVVTPVVTAVSTPVATPVLAGGAGYVSGFGGGLGGGLGGL GGGYGGYGGSFGGGAALPASYGFGAGYGAGGGFGLGFGAPPPPLGLAGGLC" polyA_site 817 /gene="LOC108064130" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgcggcaaag tcaagagtgg attttggatt ttcgattttg gattagctgg aacataggac 61 attacatcat catgaaattc tacctggcac tggcggcaat cgtggtcgtg atggcttcgg 121 cagaggccac ctttggcaag cttaatcttc tcctgggcgg cgcctccacc gctggctatg 181 gatctggata cgctggctat ggttctggct atggatcagg ctatggatac ggatcaggat 241 atggatcagg ctatggttcc ggctatggat acgctcccga gaacgtggtg aaggtgatca 301 aggtctccgt ggtgccggga ggaggagtcg gcggaggcta tggtggtggt tattccggtg 361 gctatggagg cggctactcc ggtggctact ccggtggctt tgtgggcgct gctccggcca 421 tctccacctc ggctgtggtc actccggtgg tcactgcggt gtccacaccg gtggccactc 481 ctgtgttggc cggtggtgcc ggctatgtga gtggtttcgg tggcggactg ggcggaggat 541 tgggaggatt gggtggagga tatggaggct atggaggatc cttcggcggt ggtgccgccc 601 tgcccgcctc ctacggattt ggagccggct atggagcagg cggtggcttc ggactgggat 661 tcggagcacc accaccacct ctcggtctgg ccggaggact ctgctagaca acgaggaggc 721 cacagcatcc agtggtgttt ttttttcata atcctaaaca acgatttgta atttaaagtt 781 aacgatttgt aataaagtgt aaaaataacg attaaaa