Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii keratin-associated protein 21-1


LOCUS       XM_017151510             817 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108064130), mRNA.
ACCESSION   XM_017151510
VERSION     XM_017151510.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151510.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..817
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..817
                     /gene="LOC108064130"
                     /note="keratin-associated protein 21-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108064130"
     CDS             72..707
                     /gene="LOC108064130"
                     /codon_start=1
                     /product="keratin-associated protein 21-1"
                     /protein_id="XP_017006999.2"
                     /db_xref="GeneID:108064130"
                     /translation="MKFYLALAAIVVVMASAEATFGKLNLLLGGASTAGYGSGYAGYG
                     SGYGSGYGYGSGYGSGYGSGYGYAPENVVKVIKVSVVPGGGVGGGYGGGYSGGYGGGY
                     SGGYSGGFVGAAPAISTSAVVTPVVTAVSTPVATPVLAGGAGYVSGFGGGLGGGLGGL
                     GGGYGGYGGSFGGGAALPASYGFGAGYGAGGGFGLGFGAPPPPLGLAGGLC"
     polyA_site      817
                     /gene="LOC108064130"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgcggcaaag tcaagagtgg attttggatt ttcgattttg gattagctgg aacataggac
       61 attacatcat catgaaattc tacctggcac tggcggcaat cgtggtcgtg atggcttcgg
      121 cagaggccac ctttggcaag cttaatcttc tcctgggcgg cgcctccacc gctggctatg
      181 gatctggata cgctggctat ggttctggct atggatcagg ctatggatac ggatcaggat
      241 atggatcagg ctatggttcc ggctatggat acgctcccga gaacgtggtg aaggtgatca
      301 aggtctccgt ggtgccggga ggaggagtcg gcggaggcta tggtggtggt tattccggtg
      361 gctatggagg cggctactcc ggtggctact ccggtggctt tgtgggcgct gctccggcca
      421 tctccacctc ggctgtggtc actccggtgg tcactgcggt gtccacaccg gtggccactc
      481 ctgtgttggc cggtggtgcc ggctatgtga gtggtttcgg tggcggactg ggcggaggat
      541 tgggaggatt gggtggagga tatggaggct atggaggatc cttcggcggt ggtgccgccc
      601 tgcccgcctc ctacggattt ggagccggct atggagcagg cggtggcttc ggactgggat
      661 tcggagcacc accaccacct ctcggtctgg ccggaggact ctgctagaca acgaggaggc
      721 cacagcatcc agtggtgttt ttttttcata atcctaaaca acgatttgta atttaaagtt
      781 aacgatttgt aataaagtgt aaaaataacg attaaaa