Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017151410             402 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108064065), mRNA.
ACCESSION   XM_017151410
VERSION     XM_017151410.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151410.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..402
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..402
                     /gene="LOC108064065"
                     /note="uncharacterized LOC108064065; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108064065"
     CDS             1..402
                     /gene="LOC108064065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017006899.1"
                     /db_xref="GeneID:108064065"
                     /translation="MQVLGAQLFTLAVTAVVVVTSVRGHAVEQEHLAGHAYGPAIHIS
                     SGILQLAPDAEQPQLLLVPNAHSSSLGNPWPHFYVDTLTASHLPHSSIPSIAAIPMTP
                     SIHEPRIVVSDNVDFSQLKLPQHKVVHSHGR"
ORIGIN      
        1 atgcaagtgc ttggtgctca attgtttact ttggcagtga ctgcggtagt tgtggtgact
       61 tcagttcgtg gtcacgcggt ggagcaggag catctggccg gccacgccta tggaccagcc
      121 atacacatta gttcggggat tctccaattg gcccccgatg cggagcagcc ccaattgcta
      181 ctggtgccca atgcccactc ctcgtcactg ggaaatccct ggccgcattt ctatgtagac
      241 accttgaccg cttcgcacct gccacactca tcgattccat cgatcgcagc catcccaatg
      301 accccttcga tccacgaacc acgcatcgtg gtcagcgata atgtggactt ttcgcagctc
      361 aaattgcccc agcataaagt tgtccactcc cacggtcgct aa