Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151410 402 bp mRNA linear INV 09-DEC-2024 (LOC108064065), mRNA. ACCESSION XM_017151410 VERSION XM_017151410.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151410.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..402 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..402 /gene="LOC108064065" /note="uncharacterized LOC108064065; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108064065" CDS 1..402 /gene="LOC108064065" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017006899.1" /db_xref="GeneID:108064065" /translation="MQVLGAQLFTLAVTAVVVVTSVRGHAVEQEHLAGHAYGPAIHIS SGILQLAPDAEQPQLLLVPNAHSSSLGNPWPHFYVDTLTASHLPHSSIPSIAAIPMTP SIHEPRIVVSDNVDFSQLKLPQHKVVHSHGR" ORIGIN 1 atgcaagtgc ttggtgctca attgtttact ttggcagtga ctgcggtagt tgtggtgact 61 tcagttcgtg gtcacgcggt ggagcaggag catctggccg gccacgccta tggaccagcc 121 atacacatta gttcggggat tctccaattg gcccccgatg cggagcagcc ccaattgcta 181 ctggtgccca atgcccactc ctcgtcactg ggaaatccct ggccgcattt ctatgtagac 241 accttgaccg cttcgcacct gccacactca tcgattccat cgatcgcagc catcccaatg 301 accccttcga tccacgaacc acgcatcgtg gtcagcgata atgtggactt ttcgcagctc 361 aaattgcccc agcataaagt tgtccactcc cacggtcgct aa