Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151353 689 bp mRNA linear INV 09-DEC-2024 (LOC108064025), mRNA. ACCESSION XM_017151353 VERSION XM_017151353.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151353.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..689 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..689 /gene="LOC108064025" /note="uncharacterized LOC108064025; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108064025" CDS 40..555 /gene="LOC108064025" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017006842.2" /db_xref="GeneID:108064025" /translation="MKPFACILVILAALLSVGQASLGGLLGGGGGGGGGGGGSIGGIG QLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGGGYSGGYSNGGGYSGGGGYSG GGGGYSAPAPRPVEKVVIVKVISEGYSGGQSGGYSGGYSSGGGYSNGGAQSGGWSSGG AQSSGGWNKGW" polyA_site 689 /gene="LOC108064025" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcgaaaccg attgttaccc atcccattcg ctgctcgaga tgaaaccctt tgcctgcatc 61 ctggtgatcc tagccgccct cctgtccgtt ggccaggcct ctctgggcgg tcttcttggc 121 ggcggcggcg gtggtggcgg cggaggcggt ggctccattg gaggcattgg acagctgctg 181 cagagcaagc tgggcggtct cggcggaggg ctgggcggcg gcctgggcgg tctgagcggc 241 ggtctcggcg gaaagctcgg cggtggcggt ggaggaggcg gtggtggcta ctccggtggc 301 tactccaacg gcggtggata ctccggcggc ggtggatact ccggcggcgg cggtggatac 361 tctgctcctg ctcccaggcc cgtcgagaag gtggtcattg tgaaggtcat cagcgagggc 421 tactccggcg gtcaatccgg tggctactcc ggtggctact ccagcggtgg tggctactcc 481 aatggtggcg cccagtctgg aggctggtcc tccggcggtg ctcagtcctc cggcggctgg 541 aacaagggct ggtagagagc tccaagtccc aggaaccaac cacaaatagt tcaaacctaa 601 atatagatat attttttttt tatacttttt agcggtattt tgtttgttag aatttatgca 661 atatacaaaa aaagaatttc catttttaa