Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017151353             689 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108064025), mRNA.
ACCESSION   XM_017151353
VERSION     XM_017151353.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151353.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..689
                     /gene="LOC108064025"
                     /note="uncharacterized LOC108064025; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108064025"
     CDS             40..555
                     /gene="LOC108064025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017006842.2"
                     /db_xref="GeneID:108064025"
                     /translation="MKPFACILVILAALLSVGQASLGGLLGGGGGGGGGGGGSIGGIG
                     QLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGGGYSGGYSNGGGYSGGGGYSG
                     GGGGYSAPAPRPVEKVVIVKVISEGYSGGQSGGYSGGYSSGGGYSNGGAQSGGWSSGG
                     AQSSGGWNKGW"
     polyA_site      689
                     /gene="LOC108064025"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcgaaaccg attgttaccc atcccattcg ctgctcgaga tgaaaccctt tgcctgcatc
       61 ctggtgatcc tagccgccct cctgtccgtt ggccaggcct ctctgggcgg tcttcttggc
      121 ggcggcggcg gtggtggcgg cggaggcggt ggctccattg gaggcattgg acagctgctg
      181 cagagcaagc tgggcggtct cggcggaggg ctgggcggcg gcctgggcgg tctgagcggc
      241 ggtctcggcg gaaagctcgg cggtggcggt ggaggaggcg gtggtggcta ctccggtggc
      301 tactccaacg gcggtggata ctccggcggc ggtggatact ccggcggcgg cggtggatac
      361 tctgctcctg ctcccaggcc cgtcgagaag gtggtcattg tgaaggtcat cagcgagggc
      421 tactccggcg gtcaatccgg tggctactcc ggtggctact ccagcggtgg tggctactcc
      481 aatggtggcg cccagtctgg aggctggtcc tccggcggtg ctcagtcctc cggcggctgg
      541 aacaagggct ggtagagagc tccaagtccc aggaaccaac cacaaatagt tcaaacctaa
      601 atatagatat attttttttt tatacttttt agcggtattt tgtttgttag aatttatgca
      661 atatacaaaa aaagaatttc catttttaa