PREDICTED: Drosophila takahashii phospholipase A1 (LOC108063981),

LOCUS       XM_017151275            1422 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017151275
VERSION     XM_017151275.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017151275.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1422
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1422
                     /gene="LOC108063981"
                     /note="phospholipase A1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108063981"
     CDS             1..1422
                     /gene="LOC108063981"
                     /codon_start=1
                     /product="phospholipase A1"
                     /protein_id="XP_017006764.2"
                     /db_xref="GeneID:108063981"
                     /translation="MSFSILVVLLVVLPIRADLTKESSIQSAETTEKISLGVKEFTSE
                     KSDDTTNPKIIISQFMDILGNDSSVALIFLRNKSFNKSTTEKQIVLDFLRAQTCRNGF
                     FNERPETNSVASGALNLRQLPPLYQDLLLDRLQDQLRQLFIGLPLDIAFSTLNYICST
                     IVDLGVVRSKLIPDVSRLRFLLRTEHECQNTSIPLKQAEELWDTPGFYQDRPTVLYIT
                     GWRTSINDSNSGPVAKAYGCRNDTNVLVLDAADFVDTLYTWSALNTEVIGANLAKALL
                     RLNATYVTNQFHLVGHSLGAQIAGSAGRNYRQMSGGLTLKRITGLDPANPCFYDGNDL
                     EGLRSGDARFVDIIHSNPGMLGSSKRAGDADFFVQGRIPFKEGCEGLTTISCSHQRAV
                     DYWTETVYPSNENDFLGRRCDRYAELLLGSYCRDTRTVMGYAAKPTELGLFYVAANRA
                     EPYGQNANPQTYTFSTSECGSCE"
     misc_feature    535..1335
                     /gene="LOC108063981"
                     /note="Pancreatic lipase-like enzymes. Lipases are
                     esterases that can hydrolyze long-chain acyl-triglycerides
                     into di- and monoglycerides, glycerol, and free fatty
                     acids at a water/lipid interface. A typical feature of
                     lipases is 'interfacial activation,' the...; Region:
                     Pancreat_lipase_like; cd00707"
                     /db_xref="CDD:238363"
     misc_feature    871..885
                     /gene="LOC108063981"
                     /note="nucleophilic elbow [active]"
                     /db_xref="CDD:238363"
     misc_feature    order(877..879,964..966,1162..1164)
                     /gene="LOC108063981"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238363"
     misc_feature    order(1132..1137,1153..1158)
                     /gene="LOC108063981"
                     /note="active site flap/lid"
                     /db_xref="CDD:238363"
ORIGIN      
        1 atgtcttttt cgattctagt ggtgctgctg gtggtgctgc ctattagggc agatttaaca
       61 aaggaatcct ccattcagag tgctgaaacc acagagaaaa tttctttggg cgtcaaagaa
      121 tttacttctg aaaagtcaga cgatactacg aacccaaaga taattatttc tcaatttatg
      181 gatattttgg gaaacgacag ctctgtggcc ctgatttttc tgcgaaataa gagtttcaat
      241 aaatccacta cggaaaaaca aatagtcttg gattttctaa gggcccagac ttgtaggaat
      301 ggatttttta acgagcgccc agagacaaac tctgtggcca gtggcgccct gaacttgcga
      361 cagctaccgc ccttgtatca ggacctgctc ctggaccgcc tgcaggacca gctgcgccag
      421 ctgttcatcg gcctgcccct ggacatcgcc ttctccaccc tcaactacat atgcagcacg
      481 attgtcgatc tcggcgtggt gaggtccaag ctcattcccg atgtctcgcg gctgaggttc
      541 ctcctgcgca ccgagcacga gtgccagaac accagcattc ccctcaagca ggccgaggag
      601 ctgtgggaca ctcccgggtt ttaccaggac agaccgacgg tcctgtacat caccggctgg
      661 cggacgagca tcaacgattc caacagcgga cccgtggcca aggcctatgg atgtcgcaac
      721 gataccaatg ttctggttct ggatgctgcc gactttgtgg acaccctgta tacatggtcg
      781 gcactgaaca ccgaggtgat tggagccaat ctggctaagg ccctgctgcg gctgaacgcc
      841 acctatgtga cgaaccagtt ccatttggtg ggccacagcc tgggcgccca gatagctggc
      901 tcggcgggaa ggaactatcg acagatgtcc gggggactga ccctgaagag gataaccgga
      961 ctggatccgg ccaacccctg tttctacgac ggcaacgact tggagggact gcgcagcggc
     1021 gacgcccggt tcgtggacat tatccactcg aatcccggca tgctcggctc ttcgaagcgg
     1081 gccggcgatg cggacttctt tgtccagggg cggattccct tcaaggaggg ctgcgagggc
     1141 ctcaccacca tcagctgctc gcaccagagg gccgtggact attggacgga aacggtctat
     1201 ccctcgaacg agaacgactt tctgggcagg cgatgtgatc gctatgcgga actcctgctg
     1261 ggcagctatt gtcgggacac gaggaccgtg atgggctatg ccgccaagcc cacggaactg
     1321 ggactcttct acgtggccgc caatcgagcg gagccctacg gccagaatgc caatccgcag
     1381 acctacacct tctcaaccag cgagtgcgga tcatgtgaat ga