PREDICTED: Drosophila takahashii Mediator complex subunit 22

LOCUS       XM_017151223             595 bp    mRNA    linear   INV 09-DEC-2024
            (MED22), mRNA.
ACCESSION   XM_017151223
VERSION     XM_017151223.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151223.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..595
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..595
                     /gene="MED22"
                     /note="Mediator complex subunit 22; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108063936"
     CDS             100..531
                     /gene="MED22"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /protein_id="XP_017006712.1"
                     /db_xref="GeneID:108063936"
                     /translation="MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLAR
                     RESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAIT
                     NNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK"
     misc_feature    169..471
                     /gene="MED22"
                     /note="Surfeit locus protein 5 subunit 22 of Mediator
                     complex; Region: Med22; pfam06179"
                     /db_xref="CDD:461845"
     polyA_site      595
                     /gene="MED22"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgcaccttt tccaacactg caccaaacca aacaaaaata aagcggtgct ttttagttaa
       61 attactaaat taaatttaag ttaaaagttc gcaatcacaa tggccagcgg atccaggaca
      121 acgatattgc cgcaatcgaa ggaggccctg ttgaaatcct acaatgcgcg cctgaaggac
      181 gacgtacgca gcatgctgga gaactttgag gaaatcctga agctggcgcg tcgcgagagc
      241 cacagtcaga tctccaagac gacgcaatgc gaacaggatg cgctggaaat gcaggtgcga
      301 gcggccaata tggttcgcgc tggcgaatcc ctgatgaagc tggtggccga cctcaagcag
      361 tacctcatcc tcaacgattt ccactcggta aacgaggcca tcacgaacaa ttcgcagcta
      421 tttcgcaata cccagagcga atgcgacaag aagctgatga agctgcgcga cgagatggcc
      481 atggatctgt acgatctgga ggaggagtat tacacgagca tatttaagta gccctaagtt
      541 tgtatttgaa tgtccctgaa agatacagca atgaacgtaa cgtaataact agtaa