Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribonuclease P protein subunit


LOCUS       XM_017151221             646 bp    mRNA    linear   INV 09-DEC-2024
            Rpp21 (Rpp21), mRNA.
ACCESSION   XM_017151221
VERSION     XM_017151221.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151221.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..646
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..646
                     /gene="Rpp21"
                     /note="ribonuclease P protein subunit Rpp21; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063934"
     CDS             92..646
                     /gene="Rpp21"
                     /codon_start=1
                     /product="uncharacterized protein Rpp21"
                     /protein_id="XP_017006710.2"
                     /db_xref="GeneID:108063934"
                     /translation="MSKDNNNKNKKLLAQRHISSRMNFLFQASHLMANKDQSKLAAYY
                     GKLCRNVGTKAVMHMAPALKRSLCRRCSLPLLPGVNTELQVARESREPKEPPQEIPPS
                     NGEAKKPKKKRHRRQRKKGSSQECRNPSSPPENPAETERISLYLECSLCQSRRSFPAG
                     ENQRDCWLEQPQSLVQVVSLPGER"
     misc_feature    152..382
                     /gene="Rpp21"
                     /note="RNAse P Rpr2/Rpp21/SNM1 subunit domain; Region:
                     Rpr2; pfam04032"
                     /db_xref="CDD:427665"
ORIGIN      
        1 cacacttttt ccttttccca acaatttgca atttaaaacg tttaatttta taaaacttat
       61 caaagtttgt gtgcaaaagt gaacctgtaa catgagcaag gacaacaaca acaagaacaa
      121 gaagctgctg gcccagcgac acatctcctc gcggatgaac ttcctcttcc aggcgtcgca
      181 tttaatggcc aacaaagatc agagtaaact agctgcttac tacgggaaac tctgccgaaa
      241 tgtgggcacc aaggcggtga tgcacatggc tcctgctcta aaacgctctc tttgccggcg
      301 ctgctcgctt ccgctgcttc ctggcgtgaa tacggagctg caggtggcca gggaatccag
      361 ggaacccaag gaacctcctc aggagatccc accctccaat ggggaagcca agaagcccaa
      421 gaagaagcgc catcgcaggc agcgcaagaa gggaagctcc caagagtgca gaaatccctc
      481 atcgccgcca gaaaacccag cagaaacaga acgaatctct ctctacttgg agtgctcact
      541 ctgccagagc cgccgaagct ttccggccgg cgagaaccaa agagattgct ggctagagca
      601 gccacaatcc ctggtgcaag tggtctctct gcccggagaa agataa