Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151221 646 bp mRNA linear INV 09-DEC-2024 Rpp21 (Rpp21), mRNA. ACCESSION XM_017151221 VERSION XM_017151221.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151221.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..646 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..646 /gene="Rpp21" /note="ribonuclease P protein subunit Rpp21; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063934" CDS 92..646 /gene="Rpp21" /codon_start=1 /product="uncharacterized protein Rpp21" /protein_id="XP_017006710.2" /db_xref="GeneID:108063934" /translation="MSKDNNNKNKKLLAQRHISSRMNFLFQASHLMANKDQSKLAAYY GKLCRNVGTKAVMHMAPALKRSLCRRCSLPLLPGVNTELQVARESREPKEPPQEIPPS NGEAKKPKKKRHRRQRKKGSSQECRNPSSPPENPAETERISLYLECSLCQSRRSFPAG ENQRDCWLEQPQSLVQVVSLPGER" misc_feature 152..382 /gene="Rpp21" /note="RNAse P Rpr2/Rpp21/SNM1 subunit domain; Region: Rpr2; pfam04032" /db_xref="CDD:427665" ORIGIN 1 cacacttttt ccttttccca acaatttgca atttaaaacg tttaatttta taaaacttat 61 caaagtttgt gtgcaaaagt gaacctgtaa catgagcaag gacaacaaca acaagaacaa 121 gaagctgctg gcccagcgac acatctcctc gcggatgaac ttcctcttcc aggcgtcgca 181 tttaatggcc aacaaagatc agagtaaact agctgcttac tacgggaaac tctgccgaaa 241 tgtgggcacc aaggcggtga tgcacatggc tcctgctcta aaacgctctc tttgccggcg 301 ctgctcgctt ccgctgcttc ctggcgtgaa tacggagctg caggtggcca gggaatccag 361 ggaacccaag gaacctcctc aggagatccc accctccaat ggggaagcca agaagcccaa 421 gaagaagcgc catcgcaggc agcgcaagaa gggaagctcc caagagtgca gaaatccctc 481 atcgccgcca gaaaacccag cagaaacaga acgaatctct ctctacttgg agtgctcact 541 ctgccagagc cgccgaagct ttccggccgg cgagaaccaa agagattgct ggctagagca 601 gccacaatcc ctggtgcaag tggtctctct gcccggagaa agataa