Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151219 1265 bp mRNA linear INV 09-DEC-2024 (LOC108063933), mRNA. ACCESSION XM_017151219 VERSION XM_017151219.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151219.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1265 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1265 /gene="LOC108063933" /note="gamma-butyrobetaine dioxygenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063933" CDS 1..1209 /gene="LOC108063933" /codon_start=1 /product="gamma-butyrobetaine dioxygenase" /protein_id="XP_017006708.2" /db_xref="GeneID:108063933" /translation="MLSCRKQLISRLLRRQASTLARGGYVEVQEEQGQPLKYPQVWLR DNCQCAECFHAATRARKSHWERGPINQKVSQVAYNQEKKQLEILWQDKHKSSFDLAWL RERDFGEAARERYLSEVYKPRAEIWGKSEFEAVRREFQYEDVIQKDAVLKDWLEALAI QGFAILKGAPNDVNVARHLANRIGYIKRTTYGDVFEVKSKPNAGNYAYLMTPLPLHTD MPYYEYKAGINILHTLVQSSSKGGANTLTDGFNVASRLRKDFPEDFEVLRTVPVNWFD IGHDGDQAQPFHSLWRSPVICLDVDGAITRINQNTTKRDSRFSVSMDEAIAWYRAYDR FLELAQSEAVEFKTQAGDVFVFNNLRMLHGRTAYEDAPGNKRHLVGAYVDWDIIYSKL RTLKFPNAKD" misc_feature 76..1188 /gene="LOC108063933" /note="Clavaminic acid synthetase (CAS) -like; CAS is a trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase carrying out three reactions in the biosynthesis of clavulanic acid, an inhibitor of class A serine beta-lactamases. In general, Fe(II)-2OG oxygenases...; Region: CAS_like; cl00184" /db_xref="CDD:444731" misc_feature order(553..558,655..657,661..663,676..678,829..831, 1138..1140,1144..1146) /gene="LOC108063933" /note="substrate binding pocket [chemical binding]; other site" /db_xref="CDD:238154" misc_feature order(646..648,652..654,730..732,1087..1089,1126..1128) /gene="LOC108063933" /note="active site" /db_xref="CDD:238154" misc_feature order(646..648,652..654,1087..1089) /gene="LOC108063933" /note="iron coordination sites [ion binding]; other site" /db_xref="CDD:238154" polyA_site 1265 /gene="LOC108063933" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgctgagct gtagaaaaca actaatttca cggctgctcc gccgacaagc gagcactttg 61 gctcgcggag gctatgtgga ggtacaggaa gagcagggtc agcctctcaa atacccacaa 121 gtttggctga gggacaactg ccagtgtgcc gagtgctttc atgccgccac cagggccaga 181 aaaagtcact gggagcgtgg accaattaat caaaaggtct cccaagtggc ctacaaccag 241 gagaagaagc agttggagat tctctggcag gataagcaca agagctcctt cgatttggcc 301 tggctaaggg agagggactt tggtgaggcg gccagggagc gctacttgtc ggaggtttac 361 aagccacgag cagaaatctg gggaaaatca gagttcgagg ctgtgcggcg ggagttccag 421 tacgaggatg tcatccagaa ggatgcagtg cttaaggatt ggctggaggc actggccatc 481 cagggattcg ccattctgaa aggcgctccc aacgatgtga atgtggcccg gcatttggcc 541 aacaggattg gctacataaa gcgcaccacc tacggcgacg ttttcgaggt gaaatccaag 601 ccaaatgccg ggaactacgc ctatttgatg actcctctgc cgctgcacac ggacatgccg 661 tactacgagt acaaggcggg catcaacatc ctgcacaccc tcgtccagtc gtcatccaaa 721 ggaggagcta ataccctcac cgatggcttt aatgtggctt cgcggctccg gaaagacttt 781 ccagaggact ttgaggtact gcgaacggtg ccggtgaatt ggtttgacat cggacacgat 841 ggcgatcagg cccagccctt ccacagcctg tggcgatcgc cggtgatctg tctggatgtg 901 gacggcgcga tcacgaggat caatcagaac accaccaagc gagacagccg cttctctgtt 961 tccatggacg aggccatcgc gtggtatcgc gcctacgata gattcctgga gttggcccaa 1021 tcggaggccg tggagttcaa gacccaggcg ggcgatgtct ttgtgtttaa caacctgcgc 1081 atgctgcacg gccgaacggc ctacgaggat gcgccgggca acaagcggca cttggtgggc 1141 gcctatgtcg actgggacat tatctactcc aagctgcgaa ctctcaagtt cccaaacgcc 1201 aaggactaag tttataagcc gctgtaatat ataataaaaa taatgtataa cctttgaact 1261 gtaaa