PREDICTED: Drosophila takahashii Helix loop helix protein 3B

LOCUS       XM_017151196            1243 bp    mRNA    linear   INV 09-DEC-2024
            (HLH3B), mRNA.
ACCESSION   XM_017151196
VERSION     XM_017151196.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151196.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1243
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1243
                     /gene="HLH3B"
                     /note="Helix loop helix protein 3B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063912"
     CDS             1..1116
                     /gene="HLH3B"
                     /codon_start=1
                     /product="uncharacterized protein HLH3B"
                     /protein_id="XP_017006685.2"
                     /db_xref="GeneID:108063912"
                     /translation="MAWLPSSSNGADNADERSTASSGSSGHSQTNESPHSGHLNGNGN
                     GVIREPGRHPPALLRHATPHLQPKTESVSDGDGDAELSDFSLNDTEEDEEDLRDYIVL
                     NGNQADGNRSLSSSPRSHSRNGLLTAPASSGSSVGGGGGGGNISGGNASSGGGGGGGA
                     TGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTG
                     ILEWQQRQVPALSSRGQLEPNNNDNRMTNGHAADGELENADLPAVRHIKCERTDGQPQ
                     QRNGIGNGGNDLLMIAPGAIIKSELLLESPLPLGQPLPGTPLPLSTAPLALVESRLSG
                     SVSVSGIKPTGGSRSSKRRPKPEGGATDLSLGKRRRT"
     misc_feature    493..672
                     /gene="HLH3B"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     Drosophila melanogaster helix loop helix protein 3B
                     (dHLH3B) and similar proteins; Region:
                     bHLH_TS_dHLH3B_like; cd19708"
                     /db_xref="CDD:381551"
     misc_feature    order(496..498,508..510,514..522,526..528,541..543,
                     595..597,601..606)
                     /gene="HLH3B"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381551"
     misc_feature    order(535..540,547..552,559..561,568..570,607..609,
                     616..621,628..630,634..642,646..651,658..660,667..672)
                     /gene="HLH3B"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381551"
     polyA_site      1243
                     /gene="HLH3B"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggcctggc taccgagcag ctccaatgga gcggacaacg cggacgaaag gagcacggcc
       61 tcgagcggct cctccggaca cagccagacc aacgagtccc cgcattccgg ccacctaaat
      121 ggcaatggca acggggtcat ccgggaaccc gggagacacc cgccagctct gctccggcat
      181 gccacgcccc atctgcagcc caagacagag tccgtttcgg acggagacgg cgacgcggag
      241 ctctccgact tctcgctcaa cgacaccgag gaggacgagg aggatctgcg cgactacatc
      301 gtgctgaatg gcaaccaggc ggatggcaat cgttcactgt ccagctcccc gcgaagtcac
      361 tcccgcaacg ggctgctcac agcgccggcc agctccggaa gttccgtcgg cggaggcggc
      421 ggtgggggta acatctccgg aggcaatgca tccagcggcg gcggaggagg aggaggagcc
      481 actggcggag tgcgcaaggt gttcaccaac acaagggagc gctggcgcca gcaaaacgta
      541 tccggcgcct ttgcggagct acgtaagctg gtcccgacgc atccgccgga caagaagctc
      601 tcgaagaatg agatcctgcg ctcggccatc aagtacatca agctcctgac gggcatcctc
      661 gagtggcagc agcggcaagt gcctgcactt tcatctaggg gtcaactgga gccgaacaac
      721 aacgacaacc ggatgaccaa tggccatgcg gcggacggag agttggagaa cgcggatttg
      781 ccagcggtgc ggcacataaa atgtgaacga accgacgggc agccgcagca gcggaatggg
      841 attgggaacg gaggcaacga cctgctcatg attgccccgg gagccataat caagagcgag
      901 ctcctgctgg agtcaccact gccactcgga cagccgctgc cgggcactcc actgccactg
      961 tccactgctc cgctggcgtt ggtggagtca cggctgtccg gatccgtgtc cgtttccggc
     1021 ataaagccga ctggcggcag tcggagcagc aaacgacgcc ccaagccaga gggcggagcc
     1081 accgatctca gtctgggcaa acgccgccgg acgtaggacg cagctcggcg agactgggaa
     1141 tctctggagg agtagatgcc gacgggtgcc actgtcggat agtttagatc gctcataatg
     1201 catttttttt taaactaata aatttagtag ttaatggtgt taa