PREDICTED: Drosophila takahashii 3-oxoacyl-[acyl-carrier-protein]

LOCUS       XM_017151184             889 bp    mRNA    linear   INV 09-DEC-2024
            reductase FabG (LOC108063905), mRNA.
ACCESSION   XM_017151184
VERSION     XM_017151184.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151184.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..889
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..889
                     /gene="LOC108063905"
                     /note="3-oxoacyl-[acyl-carrier-protein] reductase FabG;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 6 Proteins"
                     /db_xref="GeneID:108063905"
     CDS             27..785
                     /gene="LOC108063905"
                     /codon_start=1
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
                     /protein_id="XP_017006673.1"
                     /db_xref="GeneID:108063905"
                     /translation="MSLSNKVAIVTGASSGIGAAIAQVLAREGAILALVGRNVANLEE
                     TKKNLKAGTQAEIVVADVTKDADDIVKQTLAKFGRIDVLVNNAGILGKGGLIDLDIAE
                     FDSVLNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQF
                     TKIVALEMAPQGVRVNSVNPGFVVTNIHRTLGIVDEEYNGVLQRAIQSHPMGRVGLVT
                     EVAEAVAFLASSKASFTTGALLPIDGGKNNLTPR"
     misc_feature    33..773
                     /gene="LOC108063905"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(60..62,66..71,75..77,132..140,282..290,429..437,
                     474..476,486..488,564..575)
                     /gene="LOC108063905"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187622"
     misc_feature    order(354..356,435..437,474..476,486..488)
                     /gene="LOC108063905"
                     /note="active site"
                     /db_xref="CDD:187622"
     polyA_site      889
                     /gene="LOC108063905"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacagagcct ccagtcgtag ttcaagatga gtctcagcaa caaggtggcg atcgtgacgg
       61 gagctagcag cggaattggt gccgctattg cccaggtttt ggcccgcgaa ggtgccatct
      121 tggcgctggt gggccgcaat gtggccaatc tggaggagac caagaagaat ttgaaggcgg
      181 gcacccaggc ggaaatcgtg gtggccgatg tgaccaagga tgcggatgat attgtcaagc
      241 aaacgctggc caagttcgga cgcatcgatg tgctggtgaa taatgccggc attctcggca
      301 agggcggtct catcgatctg gatatcgccg agtttgattc cgtgctgaat accaatctgc
      361 gtggtgtcat tctcctgacc aaggctgtcc tcccgcatct cttgaagacc aagggagccg
      421 tggtgaatgt gagcagctgt gccggcattc gtcccttcgc cggtgccctc agctatggcg
      481 tctcgaaggc cgccctcgat cagttcacca agatcgtggc cctcgagatg gcgccccagg
      541 gtgtccgcgt gaattcggtg aatcccggat ttgtcgtcac caatatccat cgcaccctcg
      601 gcatcgtcga cgaggagtac aacggcgtcc tgcagcgggc catccagtcg catcccatgg
      661 gccgtgtggg cctcgtcacc gaggtcgccg aggccgtggc ctttttggcc agctccaagg
      721 ccagcttcac caccggcgcc ctcctgccca tcgatggcgg caagaacaat ctgacgcctc
      781 gttaagcgtg ctgtgcttcc agtaattacg tttcctccat tatttcctct tcattttctt
      841 cttttttttt tgttataata aataagttgt aaccacacac tgaacaaaa