Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151161 1652 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_017151161 VERSION XM_017151161.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151161.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1652 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1652 /gene="Dredd" /note="Caspase-8 Dredd; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:108063889" CDS 108..1613 /gene="Dredd" /codon_start=1 /product="caspase-8 isoform X1" /protein_id="XP_017006650.2" /db_xref="GeneID:108063889" /translation="MAGANLLTQLDAIHLDDLVYVERDLNFAQKVGLCFLLHGDDHSH ATYILQKLLVMTRSEADFPPSDLLQQYAKSRPDAWRRHLVEALCIVGARQVLRRLGFR WQELRLHYLPHVAEVALHVHPLLKSLYRICEQLTLAQSGRLVLDVGEKVARQQAGDPL RFYDPTYLEIFLLDWLTRGSLRLGDINAAGSDVQLLIEHLKFNDLQEQAKLLIDTINS NAPEAAPPAPPLVAIKQETQLDSSASSVSSASSSRRGNALELSREKAGIVLIINQQRF HRNVSEDLKQYLPSKKLQNRAGTDVDKQRLTEVFSAMNYQVEARDNVDHLDMVQLVRS ACDRSLLQDSLVVCILSHGFEEAVYGANSIALRIADIENVLCSYETLYNKPKLLIIQA CQEEALREGEENKPFKIDVTTQSPSQHVNMVRAMSTVNGFSALRHTHSGSWFIQGLCD AIDQHSASEHIADILTIVTNEVSQKRGKNDESMVPKFNSSFRQHVYFPPRL" misc_feature 882..1604 /gene="Dredd" /note="Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide...; Region: CASc; cl00042" /db_xref="CDD:444667" misc_feature order(993..995,1164..1166,1278..1280,1299..1301, 1404..1421,1431..1436) /gene="Dredd" /note="substrate pocket [chemical binding]; other site" /db_xref="CDD:237997" misc_feature order(1161..1163,1284..1286) /gene="Dredd" /note="active site" /db_xref="CDD:237997" misc_feature order(1383..1385,1392..1394,1401..1403,1470..1472, 1494..1496,1512..1514,1551..1553,1566..1571,1575..1577, 1584..1589) /gene="Dredd" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:237997" polyA_site 1652 /gene="Dredd" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttggcgggaa aaaagctgaa ctggcagccc tgaccgcacc acaaatccga actttttcgc 61 tttttcatgc gaatttgatc ttacaaactg gtactttccc gcacaacatg gccggagcga 121 atctgctgac ccagctggac gccatccacc tggacgacct ggtctacgtg gagcgcgacc 181 tgaactttgc ccagaaggtg ggcctctgct tcctgctcca cggggacgac cactcgcacg 241 ccacctacat cctgcagaag ctgctggtga tgacgcgatc ggaagccgac ttcccgccca 301 gcgatctcct ccagcagtac gccaaatccc ggccagacgc ctggcggagg cacctcgtgg 361 aggccctgtg cattgtgggc gcccgccagg tgctgcgccg cctgggcttc cgctggcagg 421 agctgcggct gcactacctg ccccacgtcg ccgaggtggc cctgcatgtg catccgctgc 481 tgaagagtct ctacaggatc tgcgagcagc tgacgctggc gcagagcggt cgcttggtcc 541 tggatgtggg cgagaaggtg gcgcgtcagc aggcgggcga tcccctgcgc ttctacgatc 601 ccacttacct ggagatcttc ctgctggact ggctcaccag gggatccctg cggctgggcg 661 acatcaatgc cgccggcagc gatgttcagc ttctgattga gcacctcaag ttcaatgatc 721 tgcaggagca ggccaagctg cttatagaca ccatcaacag caatgccccg gaggcggctc 781 ctcctgctcc tccactggtg gccatcaagc aggagacgca actggacagc tcagccagct 841 cagttagctc agccagctcc tcccggcgag ggaatgccct cgagctgagt cgcgagaagg 901 cgggcatcgt gctgatcatc aaccagcaaa ggttccaccg caatgtcagc gaggatctca 961 agcaatacct gccgtctaag aagttgcaga accgcgcagg aacggatgtg gataagcaaa 1021 gactgaccga ggtcttctcc gcgatgaact accaggtgga ggcgcgcgat aatgtggatc 1081 atttggacat ggtgcagctc gtgcgcagtg cctgcgacag atccctgctg caggactcgc 1141 tggtcgtgtg catcctgagc cacggcttcg aggaggccgt ctacggggcc aacagcatcg 1201 ccctgcggat agcggacatc gagaacgtgc tctgcagcta cgagacgctg tacaacaagc 1261 ccaagctgct catcatccag gcctgccagg aggaggcgct ccgggagggc gaggaaaaca 1321 agccattcaa gatcgatgtg accacccagt cgcccagtca gcatgtcaac atggtgcgcg 1381 ccatgtccac ggtgaacgga ttctccgccc tgcggcacac gcactcgggc agctggttca 1441 tccaggggct ctgcgatgcc atcgatcagc actccgccag cgaacacatt gccgacatcc 1501 tgaccatcgt caccaacgag gtttcccaga agcgcggcaa gaacgacgag tccatggtgc 1561 ccaagttcaa cagctcgttt cgccagcacg tctactttcc acctcgcctg tgattgcaat 1621 attatttcgt taaataaaag tgtctaaagt ta