Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Caspase-8 Dredd (Dredd),


LOCUS       XM_017151161            1652 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017151161
VERSION     XM_017151161.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151161.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1652
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1652
                     /gene="Dredd"
                     /note="Caspase-8 Dredd; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:108063889"
     CDS             108..1613
                     /gene="Dredd"
                     /codon_start=1
                     /product="caspase-8 isoform X1"
                     /protein_id="XP_017006650.2"
                     /db_xref="GeneID:108063889"
                     /translation="MAGANLLTQLDAIHLDDLVYVERDLNFAQKVGLCFLLHGDDHSH
                     ATYILQKLLVMTRSEADFPPSDLLQQYAKSRPDAWRRHLVEALCIVGARQVLRRLGFR
                     WQELRLHYLPHVAEVALHVHPLLKSLYRICEQLTLAQSGRLVLDVGEKVARQQAGDPL
                     RFYDPTYLEIFLLDWLTRGSLRLGDINAAGSDVQLLIEHLKFNDLQEQAKLLIDTINS
                     NAPEAAPPAPPLVAIKQETQLDSSASSVSSASSSRRGNALELSREKAGIVLIINQQRF
                     HRNVSEDLKQYLPSKKLQNRAGTDVDKQRLTEVFSAMNYQVEARDNVDHLDMVQLVRS
                     ACDRSLLQDSLVVCILSHGFEEAVYGANSIALRIADIENVLCSYETLYNKPKLLIIQA
                     CQEEALREGEENKPFKIDVTTQSPSQHVNMVRAMSTVNGFSALRHTHSGSWFIQGLCD
                     AIDQHSASEHIADILTIVTNEVSQKRGKNDESMVPKFNSSFRQHVYFPPRL"
     misc_feature    882..1604
                     /gene="Dredd"
                     /note="Caspase, interleukin-1 beta converting enzyme (ICE)
                     homologues; Cysteine-dependent aspartate-directed
                     proteases that mediate programmed cell death (apoptosis).
                     Caspases are synthesized as inactive zymogens and
                     activated by proteolysis of the peptide...; Region: CASc;
                     cl00042"
                     /db_xref="CDD:444667"
     misc_feature    order(993..995,1164..1166,1278..1280,1299..1301,
                     1404..1421,1431..1436)
                     /gene="Dredd"
                     /note="substrate pocket [chemical binding]; other site"
                     /db_xref="CDD:237997"
     misc_feature    order(1161..1163,1284..1286)
                     /gene="Dredd"
                     /note="active site"
                     /db_xref="CDD:237997"
     misc_feature    order(1383..1385,1392..1394,1401..1403,1470..1472,
                     1494..1496,1512..1514,1551..1553,1566..1571,1575..1577,
                     1584..1589)
                     /gene="Dredd"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237997"
     polyA_site      1652
                     /gene="Dredd"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggcgggaa aaaagctgaa ctggcagccc tgaccgcacc acaaatccga actttttcgc
       61 tttttcatgc gaatttgatc ttacaaactg gtactttccc gcacaacatg gccggagcga
      121 atctgctgac ccagctggac gccatccacc tggacgacct ggtctacgtg gagcgcgacc
      181 tgaactttgc ccagaaggtg ggcctctgct tcctgctcca cggggacgac cactcgcacg
      241 ccacctacat cctgcagaag ctgctggtga tgacgcgatc ggaagccgac ttcccgccca
      301 gcgatctcct ccagcagtac gccaaatccc ggccagacgc ctggcggagg cacctcgtgg
      361 aggccctgtg cattgtgggc gcccgccagg tgctgcgccg cctgggcttc cgctggcagg
      421 agctgcggct gcactacctg ccccacgtcg ccgaggtggc cctgcatgtg catccgctgc
      481 tgaagagtct ctacaggatc tgcgagcagc tgacgctggc gcagagcggt cgcttggtcc
      541 tggatgtggg cgagaaggtg gcgcgtcagc aggcgggcga tcccctgcgc ttctacgatc
      601 ccacttacct ggagatcttc ctgctggact ggctcaccag gggatccctg cggctgggcg
      661 acatcaatgc cgccggcagc gatgttcagc ttctgattga gcacctcaag ttcaatgatc
      721 tgcaggagca ggccaagctg cttatagaca ccatcaacag caatgccccg gaggcggctc
      781 ctcctgctcc tccactggtg gccatcaagc aggagacgca actggacagc tcagccagct
      841 cagttagctc agccagctcc tcccggcgag ggaatgccct cgagctgagt cgcgagaagg
      901 cgggcatcgt gctgatcatc aaccagcaaa ggttccaccg caatgtcagc gaggatctca
      961 agcaatacct gccgtctaag aagttgcaga accgcgcagg aacggatgtg gataagcaaa
     1021 gactgaccga ggtcttctcc gcgatgaact accaggtgga ggcgcgcgat aatgtggatc
     1081 atttggacat ggtgcagctc gtgcgcagtg cctgcgacag atccctgctg caggactcgc
     1141 tggtcgtgtg catcctgagc cacggcttcg aggaggccgt ctacggggcc aacagcatcg
     1201 ccctgcggat agcggacatc gagaacgtgc tctgcagcta cgagacgctg tacaacaagc
     1261 ccaagctgct catcatccag gcctgccagg aggaggcgct ccgggagggc gaggaaaaca
     1321 agccattcaa gatcgatgtg accacccagt cgcccagtca gcatgtcaac atggtgcgcg
     1381 ccatgtccac ggtgaacgga ttctccgccc tgcggcacac gcactcgggc agctggttca
     1441 tccaggggct ctgcgatgcc atcgatcagc actccgccag cgaacacatt gccgacatcc
     1501 tgaccatcgt caccaacgag gtttcccaga agcgcggcaa gaacgacgag tccatggtgc
     1561 ccaagttcaa cagctcgttt cgccagcacg tctactttcc acctcgcctg tgattgcaat
     1621 attatttcgt taaataaaag tgtctaaagt ta