Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151159 676 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017151159 VERSION XM_017151159.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151159.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..676 /gene="fh" /note="frataxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063886" CDS 57..629 /gene="fh" /codon_start=1 /product="frataxin homolog, mitochondrial" /protein_id="XP_017006648.2" /db_xref="GeneID:108063886" /translation="MFAGRLLARVSRQKARLATIGSWPMPQELAGHVISTRTPASGSR SIQIAECSASRRFFSSQIETESTLDAATYERVCSDTLDALCDYFEELTENASELQGTD VAYGDGVLTVNLGGKHGTYVINRQTPNKQIWLSSPTSGPKRFDFVGTVAAGRWIYKHS GQSLHELLQEEIPGILKAQSVDFLHLPYCS" misc_feature order(264..266,288..293,300..302,312..314,321..326, 354..356,360..362) /gene="fh" /note="putative iron binding site [ion binding]; other site" /db_xref="CDD:238280" misc_feature 270..575 /gene="fh" /note="frataxin; Region: mito_frataxin; TIGR03422" /db_xref="CDD:132463" polyA_site 676 /gene="fh" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgcaatcggt tggcagcccc gcagctgtga tttgtaaaaa gtaaacaaat cgaataatgt 61 ttgccggtcg tttgctcgcc cgtgtgagcc gccagaaggc acgtttggcc acaattggaa 121 gctggccaat gccccaggag ctcgccggcc atgtgatctc gaccaggaca ccggcgtcag 181 gcagtagatc gatccaaatc gcggaatgca gcgcaagccg gcggtttttc agcagccaaa 241 ttgagacgga atccacgctg gacgctgcca cctacgaacg agtgtgctcc gacaccctgg 301 atgctctgtg cgactacttc gaggagctga cggagaacgc ctcggagctc cagggcaccg 361 acgtggccta cggggatggc gtgctcaccg tgaacctggg cggcaaacac ggcacctatg 421 tgatcaaccg gcagacgccc aacaagcaga tctggctcag ttcgcccacc agcggtccca 481 agcgattcga cttcgtgggc accgtggcgg cgggcaggtg gatctacaag cacagtggtc 541 agtcgctgca cgaactgctg caggaggaga tacccggcat actgaaggcc cagtccgtgg 601 actttttgca cttgccctac tgtagttgaa ccgggagttg ctcccaccat aaagtctgtt 661 gaaacccttg atctga