Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151149 800 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017151149 VERSION XM_017151149.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151149.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..800 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..800 /gene="LOC108063879" /note="mpv17-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108063879" CDS 169..756 /gene="LOC108063879" /codon_start=1 /product="mpv17-like protein" /protein_id="XP_017006638.2" /db_xref="GeneID:108063879" /translation="MVPQAVKLLQSSLGHWRHLAGGVRLHPMAKGALTYAVMWPAGSL IQQALEGRKLSDYDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQTNLRTGIVKAIT EQLSYGPFACVSFFMGMSLLEQKTISQAVDETKEKALPTYKVGVCIWPFLQTINFSLV PEHNRVVFVSICSLMWTIFLAYMKTRHEEQAENST" misc_feature 526..711 /gene="LOC108063879" /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22; pfam04117" /db_xref="CDD:461182" polyA_site 800 /gene="LOC108063879" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcggagccgt ctagctagtc tgattagtca gatacgagat acggaagcca ggcgaaccga 61 ggagggcgcg agatgcggac gccgtgcgta accacagtac aaactagaat tccaataagt 121 tagtctaact taagatccaa aaagaatctg tcaattaaac cacttgtgat ggtgccacag 181 gctgtgaagc tgctccagtc ctccctgggc cactggcgcc acctcgccgg cggcgtgagg 241 ctgcatccca tggccaaggg cgcgctcacg tacgcggtga tgtggcccgc gggcagcctg 301 atccagcagg cgctggaggg acgcaagcta agcgactacg actgggccag ggcgctccgc 361 ttcagcctgt tcggagccct gtacgtggcg cccaccctgt acggctgggt gcggctcacc 421 agcgccatgt ggccgcagac caacctgcgc acgggcatcg tcaaggccat cacggagcag 481 ctgtcctacg gacccttcgc ctgcgtcagc ttcttcatgg gcatgagcct gctggagcag 541 aagactatca gccaggcggt ggacgagacg aaggagaagg cgctgcccac gtacaaggtc 601 ggcgtttgca tctggccctt cctgcagacc atcaacttct cgctggtgcc ggagcacaac 661 cgcgtggtgt tcgtaagcat ttgcagcctg atgtggacca tcttcctggc ctacatgaag 721 acgcgccacg aggagcaggc ggagaacagt acctagttat cgttaggcca attgttgaat 781 tagatagcat cgttagttta