Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mpv17-like protein (LOC108063879),


LOCUS       XM_017151149             800 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017151149
VERSION     XM_017151149.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151149.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..800
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..800
                     /gene="LOC108063879"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108063879"
     CDS             169..756
                     /gene="LOC108063879"
                     /codon_start=1
                     /product="mpv17-like protein"
                     /protein_id="XP_017006638.2"
                     /db_xref="GeneID:108063879"
                     /translation="MVPQAVKLLQSSLGHWRHLAGGVRLHPMAKGALTYAVMWPAGSL
                     IQQALEGRKLSDYDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQTNLRTGIVKAIT
                     EQLSYGPFACVSFFMGMSLLEQKTISQAVDETKEKALPTYKVGVCIWPFLQTINFSLV
                     PEHNRVVFVSICSLMWTIFLAYMKTRHEEQAENST"
     misc_feature    526..711
                     /gene="LOC108063879"
                     /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22;
                     pfam04117"
                     /db_xref="CDD:461182"
     polyA_site      800
                     /gene="LOC108063879"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcggagccgt ctagctagtc tgattagtca gatacgagat acggaagcca ggcgaaccga
       61 ggagggcgcg agatgcggac gccgtgcgta accacagtac aaactagaat tccaataagt
      121 tagtctaact taagatccaa aaagaatctg tcaattaaac cacttgtgat ggtgccacag
      181 gctgtgaagc tgctccagtc ctccctgggc cactggcgcc acctcgccgg cggcgtgagg
      241 ctgcatccca tggccaaggg cgcgctcacg tacgcggtga tgtggcccgc gggcagcctg
      301 atccagcagg cgctggaggg acgcaagcta agcgactacg actgggccag ggcgctccgc
      361 ttcagcctgt tcggagccct gtacgtggcg cccaccctgt acggctgggt gcggctcacc
      421 agcgccatgt ggccgcagac caacctgcgc acgggcatcg tcaaggccat cacggagcag
      481 ctgtcctacg gacccttcgc ctgcgtcagc ttcttcatgg gcatgagcct gctggagcag
      541 aagactatca gccaggcggt ggacgagacg aaggagaagg cgctgcccac gtacaaggtc
      601 ggcgtttgca tctggccctt cctgcagacc atcaacttct cgctggtgcc ggagcacaac
      661 cgcgtggtgt tcgtaagcat ttgcagcctg atgtggacca tcttcctggc ctacatgaag
      721 acgcgccacg aggagcaggc ggagaacagt acctagttat cgttaggcca attgttgaat
      781 tagatagcat cgttagttta