Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017151147             605 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063876), transcript variant X2, mRNA.
ACCESSION   XM_017151147
VERSION     XM_017151147.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151147.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..605
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..605
                     /gene="LOC108063876"
                     /note="uncharacterized LOC108063876; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063876"
     CDS             7..552
                     /gene="LOC108063876"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_017006636.2"
                     /db_xref="GeneID:108063876"
                     /translation="MWQNLKVLVGRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYD
                     WWRVLRFSMYGGLFVAPTLYGWVKISSAMWPQTSLRTGVIKAAVETVSYTPGAMTCFY
                     FIMSLLEGRMVEEAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACSL
                     CWTCFLAYMKHLEHHEVDTAI"
     misc_feature    322..507
                     /gene="LOC108063876"
                     /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22;
                     pfam04117"
                     /db_xref="CDD:461182"
     polyA_site      605
                     /gene="LOC108063876"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgcgatgt ggcagaacct caaggtgctg gtgggccgct acccgataat gcgcggcatg
       61 atatcgtaca gcctgatctg gcccacgggc agcctcatcc agcagacggt ggagggcagg
      121 cggtggggca cctacgactg gtggcgcgtg ctccggttca gcatgtacgg cggcctgttc
      181 gtggcgccca cgctctacgg ctgggtgaag atctccagcg ccatgtggcc gcagacgtcg
      241 ctgcgcacgg gcgtcatcaa ggcggcggtg gagacggtgt cctacacgcc gggcgccatg
      301 acctgcttct acttcatcat gagcctgctg gagggcagga tggtggagga ggcggtggcc
      361 gaggtgggca agaagttcct gccgacctac aaggtggctc tgtccgtctg gccactggtg
      421 gccaccatca acttcacttt gatacccgag cgcaaccgag tgcccttcat cagcgcctgc
      481 agcctgtgct ggacctgctt cctggcctac atgaagcacc tggagcacca cgaggtggac
      541 acggctattt agtgaacgta ttacttaaaa ttatactagt ttaaataaaa gttaacttta
      601 aagaa