Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151147 605 bp mRNA linear INV 09-DEC-2024 (LOC108063876), transcript variant X2, mRNA. ACCESSION XM_017151147 VERSION XM_017151147.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151147.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..605 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..605 /gene="LOC108063876" /note="uncharacterized LOC108063876; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063876" CDS 7..552 /gene="LOC108063876" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_017006636.2" /db_xref="GeneID:108063876" /translation="MWQNLKVLVGRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYD WWRVLRFSMYGGLFVAPTLYGWVKISSAMWPQTSLRTGVIKAAVETVSYTPGAMTCFY FIMSLLEGRMVEEAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACSL CWTCFLAYMKHLEHHEVDTAI" misc_feature 322..507 /gene="LOC108063876" /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22; pfam04117" /db_xref="CDD:461182" polyA_site 605 /gene="LOC108063876" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgcgatgt ggcagaacct caaggtgctg gtgggccgct acccgataat gcgcggcatg 61 atatcgtaca gcctgatctg gcccacgggc agcctcatcc agcagacggt ggagggcagg 121 cggtggggca cctacgactg gtggcgcgtg ctccggttca gcatgtacgg cggcctgttc 181 gtggcgccca cgctctacgg ctgggtgaag atctccagcg ccatgtggcc gcagacgtcg 241 ctgcgcacgg gcgtcatcaa ggcggcggtg gagacggtgt cctacacgcc gggcgccatg 301 acctgcttct acttcatcat gagcctgctg gagggcagga tggtggagga ggcggtggcc 361 gaggtgggca agaagttcct gccgacctac aaggtggctc tgtccgtctg gccactggtg 421 gccaccatca acttcacttt gatacccgag cgcaaccgag tgcccttcat cagcgcctgc 481 agcctgtgct ggacctgctt cctggcctac atgaagcacc tggagcacca cgaggtggac 541 acggctattt agtgaacgta ttacttaaaa ttatactagt ttaaataaaa gttaacttta 601 aagaa