Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151144 1622 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017151144 VERSION XM_017151144.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151144.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1622 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1622 /gene="Tre1" /note="Trapped in endoderm 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:108063874" CDS 272..1471 /gene="Tre1" /codon_start=1 /product="protein trapped in endoderm-1" /protein_id="XP_017006633.2" /db_xref="GeneID:108063874" /translation="MDKHINMGMGFAMDMDMNITTTTEAPGGPIYPHSATLFAAISAC VFVIIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRYFKES WTFGDTLCTIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLF VWVVSFLLLLPPLLGIWGQMGLDEATFSCTILKKDGRSIKKTLFVIGFLLPCLVIIVS YTCIYITVLHQKKKIRNHDNFQIGANASGAGGKGSSSGAGGTYMTTTCTRKAREDNRL TVMMVTIFLCFLVCFLPLMLANVVGSESNTKYPWVHIIASVMAWASSVINPIIYAASN RNYRVAYYKIFAMLKFWGEPLSPMPSRNYHQSKNSKELSGVIRSTPLFHAVQKNSINQ MCQTYSV" misc_feature 383..1294 /gene="Tre1" /note="G protein-coupled receptor 84 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Region: 7tmA_GPR84-like; cd15210" /db_xref="CDD:320338" misc_feature 383..463 /gene="Tre1" /note="TM helix 1 [structural motif]; Region: TM helix 1" /db_xref="CDD:320338" misc_feature 485..556 /gene="Tre1" /note="TM helix 2 [structural motif]; Region: TM helix 2" /db_xref="CDD:320338" misc_feature order(551..553,560..565,599..616,620..625,632..634, 767..769,773..787,857..859,866..874,878..886,890..895, 1142..1144,1151..1156,1160..1165,1178..1180,1193..1198, 1202..1210,1217..1219,1226..1231) /gene="Tre1" /note="putative ligand binding pocket [chemical binding]; other site" /db_xref="CDD:320338" misc_feature 599..691 /gene="Tre1" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:320338" misc_feature 731..787 /gene="Tre1" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:320338" misc_feature 857..934 /gene="Tre1" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:320338" misc_feature 1082..1180 /gene="Tre1" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:320338" misc_feature 1196..1273 /gene="Tre1" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:320338" polyA_site 1622 /gene="Tre1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtttctcat tcctgctcga tcggttaagt cggtttcgct gcggcgctgc gctgttgttg 61 tcactactat tgctgttaat tgccaaagaa aatacgacct tttcgctgtg cgatcggaga 121 tctccatctc tctcgataag tcaaagtcgg aatataatat atgtgcactt ttttttgctg 181 tgctccgcgg tttgtgtcaa caaaatgcaa ttcgaaagca tttaagaaac gcgaaacgaa 241 gaatatataa taagcggaaa acaagttcgg aatggacaag cacataaata tgggaatggg 301 attcgcaatg gacatggaca tgaacattac gacgaccaca gaagcccccg gaggtccgat 361 atacccgcat tcggcgacat tattcgcggc aattagtgcc tgtgtctttg tgataatcgg 421 cgttcttggc aacctgatta ccctgctggc gctgctcaag agtccaacga tacgggaaca 481 cgccaccacc gccttcgtca tctcgctgag catctccgac ctgctcttct gctccttcag 541 tctgcccctg acggcggttc gctacttcaa ggagagctgg acctttggcg acaccctgtg 601 cacgatcttc ccggtgatct tctatggcaa cgtggccgtt tcactcctca gcatggtggg 661 catcacgctg aacagatata tactcatcgc ttgccacagc cgctactcgc agatttacaa 721 gccgaagttc ataaccctgc agctgttgtt cgtttgggtc gtgtcatttc ttctgctgct 781 accgcctctt ctgggcatct ggggccagat gggcctggac gaggccacct tctcctgcac 841 aattctcaag aaggacggac gatcgatcaa gaagaccctg ttcgtgatcg gcttcctgct 901 gccctgcctg gtcatcattg tctcgtacac ctgcatctac atcacggtgc tgcaccagaa 961 gaagaagatc cgcaaccacg acaacttcca gatcggtgcg aatgcgagtg gtgcgggggg 1021 aaagggatcc tccagcggcg ccggcggaac ctacatgacc accacctgca cgcgaaaggc 1081 gcgcgaggac aaccgactga ccgtcatgat ggtcaccatc ttcctgtgct tcctcgtctg 1141 cttcctgccc ctgatgctgg ccaatgtggt gggcagcgag agcaacacca agtacccctg 1201 ggtgcatatc atcgcctcgg tgatggcctg ggcctccagt gtcatcaatc cgatcatcta 1261 tgcggccagc aatcgcaact acagggtggc ctactacaag atcttcgcga tgctcaagtt 1321 ctggggcgaa ccgctgtcgc cgatgccgag tagaaactat caccaaagca aaaactcgaa 1381 ggagctgtcg ggcgtcatcc gcagcacgcc gctcttccac gctgtgcaga agaatagtat 1441 taaccaaatg tgccaaacat attcagtata atcaagattg ctgtcgagtc tttgtattag 1501 agctagtaag tagttcatat tgattaccta ctgattactt tttagtctat aaaattatta 1561 acgatgtacg gcagtgctta catcaaagac aatcgaatta aatatatatg tatgtagacc 1621 aa