Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Trapped in endoderm 1 (Tre1),


LOCUS       XM_017151144            1622 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017151144
VERSION     XM_017151144.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151144.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1622
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1622
                     /gene="Tre1"
                     /note="Trapped in endoderm 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:108063874"
     CDS             272..1471
                     /gene="Tre1"
                     /codon_start=1
                     /product="protein trapped in endoderm-1"
                     /protein_id="XP_017006633.2"
                     /db_xref="GeneID:108063874"
                     /translation="MDKHINMGMGFAMDMDMNITTTTEAPGGPIYPHSATLFAAISAC
                     VFVIIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRYFKES
                     WTFGDTLCTIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLF
                     VWVVSFLLLLPPLLGIWGQMGLDEATFSCTILKKDGRSIKKTLFVIGFLLPCLVIIVS
                     YTCIYITVLHQKKKIRNHDNFQIGANASGAGGKGSSSGAGGTYMTTTCTRKAREDNRL
                     TVMMVTIFLCFLVCFLPLMLANVVGSESNTKYPWVHIIASVMAWASSVINPIIYAASN
                     RNYRVAYYKIFAMLKFWGEPLSPMPSRNYHQSKNSKELSGVIRSTPLFHAVQKNSINQ
                     MCQTYSV"
     misc_feature    383..1294
                     /gene="Tre1"
                     /note="G protein-coupled receptor 84 and similar proteins,
                     member of the class A family of seven-transmembrane G
                     protein-coupled receptors; Region: 7tmA_GPR84-like;
                     cd15210"
                     /db_xref="CDD:320338"
     misc_feature    383..463
                     /gene="Tre1"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320338"
     misc_feature    485..556
                     /gene="Tre1"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320338"
     misc_feature    order(551..553,560..565,599..616,620..625,632..634,
                     767..769,773..787,857..859,866..874,878..886,890..895,
                     1142..1144,1151..1156,1160..1165,1178..1180,1193..1198,
                     1202..1210,1217..1219,1226..1231)
                     /gene="Tre1"
                     /note="putative ligand binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:320338"
     misc_feature    599..691
                     /gene="Tre1"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320338"
     misc_feature    731..787
                     /gene="Tre1"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320338"
     misc_feature    857..934
                     /gene="Tre1"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320338"
     misc_feature    1082..1180
                     /gene="Tre1"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320338"
     misc_feature    1196..1273
                     /gene="Tre1"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320338"
     polyA_site      1622
                     /gene="Tre1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtttctcat tcctgctcga tcggttaagt cggtttcgct gcggcgctgc gctgttgttg
       61 tcactactat tgctgttaat tgccaaagaa aatacgacct tttcgctgtg cgatcggaga
      121 tctccatctc tctcgataag tcaaagtcgg aatataatat atgtgcactt ttttttgctg
      181 tgctccgcgg tttgtgtcaa caaaatgcaa ttcgaaagca tttaagaaac gcgaaacgaa
      241 gaatatataa taagcggaaa acaagttcgg aatggacaag cacataaata tgggaatggg
      301 attcgcaatg gacatggaca tgaacattac gacgaccaca gaagcccccg gaggtccgat
      361 atacccgcat tcggcgacat tattcgcggc aattagtgcc tgtgtctttg tgataatcgg
      421 cgttcttggc aacctgatta ccctgctggc gctgctcaag agtccaacga tacgggaaca
      481 cgccaccacc gccttcgtca tctcgctgag catctccgac ctgctcttct gctccttcag
      541 tctgcccctg acggcggttc gctacttcaa ggagagctgg acctttggcg acaccctgtg
      601 cacgatcttc ccggtgatct tctatggcaa cgtggccgtt tcactcctca gcatggtggg
      661 catcacgctg aacagatata tactcatcgc ttgccacagc cgctactcgc agatttacaa
      721 gccgaagttc ataaccctgc agctgttgtt cgtttgggtc gtgtcatttc ttctgctgct
      781 accgcctctt ctgggcatct ggggccagat gggcctggac gaggccacct tctcctgcac
      841 aattctcaag aaggacggac gatcgatcaa gaagaccctg ttcgtgatcg gcttcctgct
      901 gccctgcctg gtcatcattg tctcgtacac ctgcatctac atcacggtgc tgcaccagaa
      961 gaagaagatc cgcaaccacg acaacttcca gatcggtgcg aatgcgagtg gtgcgggggg
     1021 aaagggatcc tccagcggcg ccggcggaac ctacatgacc accacctgca cgcgaaaggc
     1081 gcgcgaggac aaccgactga ccgtcatgat ggtcaccatc ttcctgtgct tcctcgtctg
     1141 cttcctgccc ctgatgctgg ccaatgtggt gggcagcgag agcaacacca agtacccctg
     1201 ggtgcatatc atcgcctcgg tgatggcctg ggcctccagt gtcatcaatc cgatcatcta
     1261 tgcggccagc aatcgcaact acagggtggc ctactacaag atcttcgcga tgctcaagtt
     1321 ctggggcgaa ccgctgtcgc cgatgccgag tagaaactat caccaaagca aaaactcgaa
     1381 ggagctgtcg ggcgtcatcc gcagcacgcc gctcttccac gctgtgcaga agaatagtat
     1441 taaccaaatg tgccaaacat attcagtata atcaagattg ctgtcgagtc tttgtattag
     1501 agctagtaag tagttcatat tgattaccta ctgattactt tttagtctat aaaattatta
     1561 acgatgtacg gcagtgctta catcaaagac aatcgaatta aatatatatg tatgtagacc
     1621 aa