Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151143 687 bp mRNA linear INV 09-DEC-2024 factor 8 (Coa8), mRNA. ACCESSION XM_017151143 VERSION XM_017151143.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151143.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..687 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..687 /gene="Coa8" /note="Cytochrome c oxidase assembly factor 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063873" CDS 84..620 /gene="Coa8" /codon_start=1 /product="COA8 family protein CG14806, mitochondrial" /protein_id="XP_017006632.2" /db_xref="GeneID:108063873" /translation="MNKCLRHQPRILLSQLGLPRFYAAVQAEPPQKKPAPRVGLAHRP DPKSVKCDYIGPPDAESNLRPYVRHYDDEETRLARSLRLKRIEVEAWNTDFWTRHNRR FYEEKEDFMRLHRESGSSEVSADQMSHFYKAFLDKNWRIHMMYNISWYLKNLDILTLA AGVQLQRLLALAKRRRST" misc_feature 234..590 /gene="Coa8" /note="Cytochrome c oxidase assembly factor 8; Region: COA8; pfam10231" /db_xref="CDD:463011" polyA_site 687 /gene="Coa8" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagtctgtgt tacagtgttc cagccggtca cactagcgaa ctgacataac atagtattat 61 cgataataat aataaaccga aagatgaaca aatgccttag gcaccagccc cggatactgc 121 tctcccagct cggcctcccg cggttctatg ccgccgtcca ggcggagcca ccacagaaga 181 agcccgctcc cagggtggga ctggcccaca ggcccgatcc caagtcggtg aagtgcgact 241 acattgggcc gccggacgcg gagtccaacc tgcggccata tgtgcggcac tacgacgacg 301 aggagacgcg gctggcgagg agcctgcggc tcaagcggat cgaggtggag gcctggaaca 361 cggacttctg gacgcggcac aacaggcgct tctacgagga gaaggaggac ttcatgcggc 421 tgcacaggga gagcgggagc agcgaggtct ccgcggacca gatgagccac ttctacaagg 481 cgttcctcga caagaactgg cgcatccaca tgatgtacaa tatctcgtgg tacctcaaga 541 acctcgacat cctcaccctg gccgccggag tccagctgca gcggctcctc gcgctggcca 601 agcggcggag gtccacgtag atgcaaaatt cctagtcaaa tccctttact ttgccatgac 661 tcgaaataaa agatcgtgtg tgtaaaa