Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cytochrome c oxidase assembly


LOCUS       XM_017151143             687 bp    mRNA    linear   INV 09-DEC-2024
            factor 8 (Coa8), mRNA.
ACCESSION   XM_017151143
VERSION     XM_017151143.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151143.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..687
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..687
                     /gene="Coa8"
                     /note="Cytochrome c oxidase assembly factor 8; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108063873"
     CDS             84..620
                     /gene="Coa8"
                     /codon_start=1
                     /product="COA8 family protein CG14806, mitochondrial"
                     /protein_id="XP_017006632.2"
                     /db_xref="GeneID:108063873"
                     /translation="MNKCLRHQPRILLSQLGLPRFYAAVQAEPPQKKPAPRVGLAHRP
                     DPKSVKCDYIGPPDAESNLRPYVRHYDDEETRLARSLRLKRIEVEAWNTDFWTRHNRR
                     FYEEKEDFMRLHRESGSSEVSADQMSHFYKAFLDKNWRIHMMYNISWYLKNLDILTLA
                     AGVQLQRLLALAKRRRST"
     misc_feature    234..590
                     /gene="Coa8"
                     /note="Cytochrome c oxidase assembly factor 8; Region:
                     COA8; pfam10231"
                     /db_xref="CDD:463011"
     polyA_site      687
                     /gene="Coa8"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagtctgtgt tacagtgttc cagccggtca cactagcgaa ctgacataac atagtattat
       61 cgataataat aataaaccga aagatgaaca aatgccttag gcaccagccc cggatactgc
      121 tctcccagct cggcctcccg cggttctatg ccgccgtcca ggcggagcca ccacagaaga
      181 agcccgctcc cagggtggga ctggcccaca ggcccgatcc caagtcggtg aagtgcgact
      241 acattgggcc gccggacgcg gagtccaacc tgcggccata tgtgcggcac tacgacgacg
      301 aggagacgcg gctggcgagg agcctgcggc tcaagcggat cgaggtggag gcctggaaca
      361 cggacttctg gacgcggcac aacaggcgct tctacgagga gaaggaggac ttcatgcggc
      421 tgcacaggga gagcgggagc agcgaggtct ccgcggacca gatgagccac ttctacaagg
      481 cgttcctcga caagaactgg cgcatccaca tgatgtacaa tatctcgtgg tacctcaaga
      541 acctcgacat cctcaccctg gccgccggag tccagctgca gcggctcctc gcgctggcca
      601 agcggcggag gtccacgtag atgcaaaatt cctagtcaaa tccctttact ttgccatgac
      661 tcgaaataaa agatcgtgtg tgtaaaa