Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii large ribosomal subunit protein


LOCUS       XM_017151141             464 bp    mRNA    linear   INV 09-DEC-2024
            mL63 (LOC108063870), mRNA.
ACCESSION   XM_017151141
VERSION     XM_017151141.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151141.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..464
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..464
                     /gene="LOC108063870"
                     /note="large ribosomal subunit protein mL63; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108063870"
     CDS             84..404
                     /gene="LOC108063870"
                     /codon_start=1
                     /product="large ribosomal subunit protein mL63"
                     /protein_id="XP_017006630.3"
                     /db_xref="GeneID:108063870"
                     /translation="MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTREYERQE
                     QVMLLLRHPYLTLEQSSGHAKELQKREKLVAKWTDEQTLRKMKPHVTIEERLSQLKIK
                     EAWD"
     misc_feature    123..398
                     /gene="LOC108063870"
                     /note="Mitochondrial ribosome protein 63; Region: MRP-63;
                     pfam14978"
                     /db_xref="CDD:434363"
     polyA_site      464
                     /gene="LOC108063870"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggttcccgat atcgaatagc gataggcccc gataggcgtt acatatttta tttacactat
       61 ttgtaaatta aatttaccga aaaatgcacc tgacgctgat caacctgttc aagaagaccg
      121 tgccgggcca catattccgc ggcaagcggc gcctggtgaa gccggtcagc cagcgggcga
      181 tggacaccct gacccgggag tacgagcgcc aggagcaggt gatgctgctc ctccggcacc
      241 cctacttgac cctggaacag tcatccggac acgccaagga gctgcagaag cgcgagaagc
      301 tggtggccaa gtggacggac gagcagacgc tgcgcaagat gaagccgcac gtgaccatcg
      361 aggaacggct gagccagctg aagatcaagg aggcctggga ctagccggct tcgtctgttg
      421 aagccttgtt acttgtacaa taaatataga ttttatggaa atta