Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151141 464 bp mRNA linear INV 09-DEC-2024 mL63 (LOC108063870), mRNA. ACCESSION XM_017151141 VERSION XM_017151141.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151141.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..464 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..464 /gene="LOC108063870" /note="large ribosomal subunit protein mL63; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063870" CDS 84..404 /gene="LOC108063870" /codon_start=1 /product="large ribosomal subunit protein mL63" /protein_id="XP_017006630.3" /db_xref="GeneID:108063870" /translation="MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTREYERQE QVMLLLRHPYLTLEQSSGHAKELQKREKLVAKWTDEQTLRKMKPHVTIEERLSQLKIK EAWD" misc_feature 123..398 /gene="LOC108063870" /note="Mitochondrial ribosome protein 63; Region: MRP-63; pfam14978" /db_xref="CDD:434363" polyA_site 464 /gene="LOC108063870" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggttcccgat atcgaatagc gataggcccc gataggcgtt acatatttta tttacactat 61 ttgtaaatta aatttaccga aaaatgcacc tgacgctgat caacctgttc aagaagaccg 121 tgccgggcca catattccgc ggcaagcggc gcctggtgaa gccggtcagc cagcgggcga 181 tggacaccct gacccgggag tacgagcgcc aggagcaggt gatgctgctc ctccggcacc 241 cctacttgac cctggaacag tcatccggac acgccaagga gctgcagaag cgcgagaagc 301 tggtggccaa gtggacggac gagcagacgc tgcgcaagat gaagccgcac gtgaccatcg 361 aggaacggct gagccagctg aagatcaagg aggcctggga ctagccggct tcgtctgttg 421 aagccttgtt acttgtacaa taaatataga ttttatggaa atta