Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151140 1165 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_017151140 VERSION XM_017151140.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151140.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1165 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1165 /gene="Pgam5" /note="Phosphoglycerate mutase 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063869" CDS 63..929 /gene="Pgam5" /codon_start=1 /product="serine/threonine-protein phosphatase Pgam5, mitochondrial isoform X2" /protein_id="XP_017006629.2" /db_xref="GeneID:108063869" /translation="MRKLTSFVCGTGAGLAAYYLQRLRDPQAAVQNSWTHSDKPVDPW ALWDSNWDCREPRALVRPLRNGQPEEENRFNAELEKAKAKKPRHIILVRHGEYLDAGD SDDTHHLTERGRKQAEFTGKRLSELGIKWDKVVASTMVRAQETSDIILQQIDFDKEKV VNCAFLREGAPIPPQPPVGHWKPEASFLRDGSRIEAAFRRYFHRAYPDQEKESHTLIV GHGNVIRYFVCRALQFPAEGWLRISINHASITWLTISPSGNVSIKYLGDSGFMPAALL TNRIPREAKNVV" misc_feature <201..893 /gene="Pgam5" /note="Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP; cl11399" /db_xref="CDD:472174" misc_feature order(339..344,483..485,720..725) /gene="Pgam5" /note="catalytic core [active]" /db_xref="CDD:132718" polyA_site 1165 /gene="Pgam5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttaaataccg cacttcccac tcagcgggac aacaaataat tttagaggaa ttaagataca 61 agatgcgcaa gttgaccagc ttcgtgtgcg gcacaggcgc cggcctggcg gcctactacc 121 tgcagcggct gcgcgacccc caggcggcgg tgcagaactc gtggacgcac agcgacaagc 181 cggtggaccc gtgggccctc tgggactcca actgggactg ccgggagccg cgggcgctgg 241 tccgcccgct gcgcaacggc cagccggagg aggagaaccg cttcaacgcg gagctggaga 301 aggccaaggc caagaagccg cgccacatca tcctggtgcg gcacggcgag tacctggacg 361 cgggcgactc ggacgacacg caccacctca ccgagcgcgg ccgcaagcag gcggagttca 421 ccggcaagcg gctcagcgag ctgggcatca agtgggacaa ggtggtggcc tccaccatgg 481 tgcgggccca ggagacctcg gacatcatcc tgcagcagat cgacttcgac aaggagaagg 541 tggtcaactg cgccttcctg cgcgaggggg cgcccattcc gccccagccg ccggtgggcc 601 actggaagcc ggaggcatct ttcctccgcg acggatcgcg catcgaggcc gccttccggc 661 gctacttcca ccgcgcctac cccgaccagg agaaggagag ccacacgctg atcgtgggcc 721 acggcaacgt gatccgctac ttcgtctgcc gcgccctcca gttccccgcc gagggctggc 781 tgcgcatcag catcaaccac gcctccatca cctggctgac catcagtccg tcgggcaacg 841 tgtccatcaa gtacctgggc gactcgggct tcatgcccgc cgccctgctc acgaaccgca 901 tcccgcggga ggccaagaat gtggtgtaga gtctcctgaa actgccctcc aaactgccag 961 gatgagaggc atcctagtgt atttattgcc aggccttaaa gtaaatccgt aagctcagat 1021 ggtgtatttg tatagatgat catgtaaagt attgccgcat gttagagtca atctccaggg 1081 gaggaggatc gccttccgac tgaagtaata acatttttta tagaatgcca aacattaaag 1141 aagggtttct tgatttacac aagga