Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Phosphoglycerate mutase 5 (Pgam5),


LOCUS       XM_017151139            1168 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017151139
VERSION     XM_017151139.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151139.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1168
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1168
                     /gene="Pgam5"
                     /note="Phosphoglycerate mutase 5; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063869"
     CDS             63..932
                     /gene="Pgam5"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase Pgam5,
                     mitochondrial isoform X1"
                     /protein_id="XP_017006628.2"
                     /db_xref="GeneID:108063869"
                     /translation="MRKLTSFVCGTGAGLAAYYLQRLRDPQAAVQNSWTHSDKPVDPW
                     ALWDSNWDCREPRALVRPLRNGQPEEENRFNAELEKAKAKKPRHIILVRHGEYLDAGD
                     SDDTHHLTERGRKQAEFTGKRLSELGIKWDKVVASTMVRAQETSDIILQQIDFDKEKV
                     VNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAAFRRYFHRAYPDQEKESHTLI
                     VGHGNVIRYFVCRALQFPAEGWLRISINHASITWLTISPSGNVSIKYLGDSGFMPAAL
                     LTNRIPREAKNVV"
     misc_feature    <201..896
                     /gene="Pgam5"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:472174"
     misc_feature    order(339..344,483..485,723..728)
                     /gene="Pgam5"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     polyA_site      1168
                     /gene="Pgam5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttaaataccg cacttcccac tcagcgggac aacaaataat tttagaggaa ttaagataca
       61 agatgcgcaa gttgaccagc ttcgtgtgcg gcacaggcgc cggcctggcg gcctactacc
      121 tgcagcggct gcgcgacccc caggcggcgg tgcagaactc gtggacgcac agcgacaagc
      181 cggtggaccc gtgggccctc tgggactcca actgggactg ccgggagccg cgggcgctgg
      241 tccgcccgct gcgcaacggc cagccggagg aggagaaccg cttcaacgcg gagctggaga
      301 aggccaaggc caagaagccg cgccacatca tcctggtgcg gcacggcgag tacctggacg
      361 cgggcgactc ggacgacacg caccacctca ccgagcgcgg ccgcaagcag gcggagttca
      421 ccggcaagcg gctcagcgag ctgggcatca agtgggacaa ggtggtggcc tccaccatgg
      481 tgcgggccca ggagacctcg gacatcatcc tgcagcagat cgacttcgac aaggagaagg
      541 tggtcaactg cgccttcctg cgcgaggggg cgcccattcc gccccagccg ccggtgggcc
      601 actggaagcc ggaggcatct cagttcctcc gcgacggatc gcgcatcgag gccgccttcc
      661 ggcgctactt ccaccgcgcc taccccgacc aggagaagga gagccacacg ctgatcgtgg
      721 gccacggcaa cgtgatccgc tacttcgtct gccgcgccct ccagttcccc gccgagggct
      781 ggctgcgcat cagcatcaac cacgcctcca tcacctggct gaccatcagt ccgtcgggca
      841 acgtgtccat caagtacctg ggcgactcgg gcttcatgcc cgccgccctg ctcacgaacc
      901 gcatcccgcg ggaggccaag aatgtggtgt agagtctcct gaaactgccc tccaaactgc
      961 caggatgaga ggcatcctag tgtatttatt gccaggcctt aaagtaaatc cgtaagctca
     1021 gatggtgtat ttgtatagat gatcatgtaa agtattgccg catgttagag tcaatctcca
     1081 ggggaggagg atcgccttcc gactgaagta ataacatttt ttatagaatg ccaaacatta
     1141 aagaagggtt tcttgattta cacaagga