Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii armadillo (arm), transcript


LOCUS       XM_017151128            3221 bp    mRNA    linear   INV 09-DEC-2024
            variant X3, mRNA.
ACCESSION   XM_017151128
VERSION     XM_017151128.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151128.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3221
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3221
                     /gene="arm"
                     /note="armadillo; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:108063862"
     CDS             179..2710
                     /gene="arm"
                     /codon_start=1
                     /product="armadillo segment polarity protein isoform X1"
                     /protein_id="XP_017006617.1"
                     /db_xref="GeneID:108063862"
                     /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS
                     GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT
                     LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG
                     GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAAGNGGAVGGAGGGGGNIGPIPPSG
                     APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC"
     misc_feature    431..655
                     /gene="arm"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(449..460,470..475,479..487,494..499,506..508,
                     560..568,572..577,584..589,596..598,605..631)
                     /gene="arm"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <626..>1120
                     /gene="arm"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    659..736
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    755..871
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    890..988
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(959..961,971..973,983..985,1085..1087,1097..1099,
                     1109..1111,1214..1216,1226..1228,1238..1240)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1010..1120
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1136..1243
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1259..1372
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1262..1369
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1406..1483
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1454..1456,1466..1468,1478..1480,1586..1588,
                     1598..1600,1610..1612,1724..1726,1736..1738,1748..1750)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1493..1621
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1505..1621
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1646..1753
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1928..1930,1940..1942,1952..1954,2051..2053,
                     2063..2065,2075..2077,2174..2176,2186..2188,2198..2200)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1967..2086
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1976..2086
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2099..2203
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     polyA_site      3221
                     /gene="arm"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attctgttcc gttttaacga gcgtgctggt cggtcgcatt ttccgctgcg ccttttccag
       61 aagctgcgag tgaagcacaa ttattttggt ttttctttga gtgcatcaga tttgaaaaag
      121 tgccaaacat agtaattaaa taactcaagg tgtggtgtaa agcgccttaa tcaccaagat
      181 gagttacatg ccagcccaga atcgtaccat gtcgcataat aatcaataca atccgccgga
      241 tctcccgccg atggtgtccg ccaaggagca gaccctcatg tggcagcaga actcgtatct
      301 gggcgactcc ggcatccact cgggggccgt gacccaggtg ccgtcgctgt ccggcaagga
      361 ggacgaggag atggaggggg atcccctgat gttcgacctg gacaccgggt tcccgcagaa
      421 ctttacgcag gaccaggtgg acgacatgaa ccagcagctg agccagacgc gctcccaacg
      481 cgtccgggct gccatgttcc cggagacgct ggaggagggc atcgagattc cctccaccca
      541 gttcgatccc cagcagccga cggcggtgca gcgtctctcg gagccgtcgc agatgctgaa
      601 gcacgcggtg gtgaatctga tcaactacca ggacgacgcc gagctggcca ccagggccat
      661 tccggagctg atcaagctgc tgaacgacga ggaccaggtg gtcgtctccc aggcggccat
      721 gatggtccac cagctgtcca agaaggaggc ctcgcgccac gccatcatga acagccccca
      781 gatggtggcc gccctggtgc gcgccatctc caacagcaac gatctggaga gcaccaaggc
      841 cgcggtgggc acgctgcaca acttgtcgca ccatcgccag ggcctcctgg ccatcttcaa
      901 gagcggcgga atcccggcac tcgtcaagct gctctcctcg ccggtggaga gtgtgctctt
      961 ctacgcaata accacgctgc acaacctgct gctccaccag gacggctcca agatggccgt
     1021 acgcctggcc ggcggcctcc agaagatggt cacgctgctg cagaggaaca acgtcaagtt
     1081 cctggccatc gtcaccgatt gcctgcagat tctggcctac ggcaaccagg agagcaagct
     1141 cataatcctc gcctccggcg ggccgaacga gctggtgcgc atcatgcgct cctacgacta
     1201 cgagaagctg ctgtggacca cctcgcgggt gctcaaggtg ctgtccgtct gctccagcaa
     1261 caagccggcc atcgtggacg ccggcggcat gcaggcgctg gccatgcacc tgggcaacat
     1321 gtcgccgcgc ctcgtgcaga actgtctgtg gacactgcgc aacctgtccg acgcggccac
     1381 caaggtggag ggtctcgagg ccctgctcca gtcgctcgtc caggtcctgg gctccaccga
     1441 tgtcaacgtg gtcacctgtg ccgccggcat cctctcgaat ctgacgtgca acaatcagcg
     1501 caacaaggcc accgtctgcc aggtgggcgg cgtggacgcc ctcgtccgca ccatcatcaa
     1561 tgccggggat cgcgaggaga tcaccgagcc ggccgtttgc gccctgcgcc acctgacctc
     1621 gcgtcacgtg gactcggagc tggcccagaa tgccgtgcgt ctcaactacg ggctgtcggt
     1681 gattgtgaag ctgctgcatc caccgtcccg ctggccgttg atcaaggccg tcattgggct
     1741 catacgcaac ttggccctct gtccggccaa ccacgccccg ttgcgggagc acggggccat
     1801 ccatcacctg gtgcggctgc taatgcgcgc cttccaggac acagagaggc aacgctcctc
     1861 gattgccacc acgggctccc agcagccgtc tgcctacgcc gacggcgtgc gcatggagga
     1921 gattgtcgag ggcacggtgg gggccctgca tatcctggcc cgtgagtccc acaaccgggc
     1981 gctcattcgc cagcagtcgg tgataccgat ctttgtgcgt ttgctgttca acgaaatcga
     2041 gaatattcag cgcgtggctg ctggggttct ttgtgagctg gccgccgaca aggagggcgc
     2101 cgagattatc gagcaggagg gcgccaccgg gccgctgacc gacctgctgc actcgcgcaa
     2161 cgagggcgtg gccacgtacg ctgccgccgt gctcttccgc atgagcgagg acaagccgca
     2221 ggactacaag aagcgcctgt ccatcgagct gaccaactcg ctgctgcgcg aggacaacaa
     2281 catttgggcc aacgccgacc tgggcatggg tcccgatctg caggatatgc ttggaccaga
     2341 agaagcatat gaaggcctgt acggacaagg tccgcccagc gtgcacagtt cgcacggagg
     2401 tcgcgcattc catcagcaag gatatgatac tctaccaata gattcgatgc agggtctgga
     2461 gatcagcagc ccggtgggcg gcggcggcgc tggcggtgct gccggcaatg gtggagcggt
     2521 gggcggagct ggcggcggcg gcggcaacat cggccccatc ccgcccagcg gcgcacccac
     2581 atcaccctac tccatggaca tggatgtcgg cgagattgat gccggtgcat tgaactttga
     2641 tttggacgcc atgccgacgc cacccaatga caacaacaat ctggctgcct ggtacgacac
     2701 cgactgctag acgacgatga cgaggagcga gcgaaagagc cgagctaagg gtaagggtcg
     2761 aggagcatca atccattcga ccccaaaaac gagataacac aaaacacacg agtcccccgt
     2821 cccagcaata tagccctttt ccactaggac gtggagatgc agatggagat ggagcaatca
     2881 ctgatgaccg atcaccgata taccgatatt gactagatca acggagagtg ttgattttac
     2941 ttgacaaaga cgaggaagga agataggatg ctgcggcagg aagagcgaga cgaaggcaat
     3001 ccgaaggtcc gtgtccgtgg aagaaggcta ttgttcacac acccctcgac aaacatacac
     3061 acccacacgg gcatactggc atacatgaat aatattatat attaattata atgcgaacgc
     3121 agcggcataa aacatattat atgatgcatt acatattatc cacgtaaacg aaatggaaaa
     3181 ttaaacaaat gtttgcaata gaactcgtac atttcccttc a