Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii armadillo (arm), transcript


LOCUS       XM_017151127            3224 bp    mRNA    linear   INV 09-DEC-2024
            variant X2, mRNA.
ACCESSION   XM_017151127
VERSION     XM_017151127.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151127.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3224
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3224
                     /gene="arm"
                     /note="armadillo; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:108063862"
     CDS             182..2713
                     /gene="arm"
                     /codon_start=1
                     /product="armadillo segment polarity protein isoform X1"
                     /protein_id="XP_017006616.1"
                     /db_xref="GeneID:108063862"
                     /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS
                     GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT
                     LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG
                     GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAAGNGGAVGGAGGGGGNIGPIPPSG
                     APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC"
     misc_feature    434..658
                     /gene="arm"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(452..463,473..478,482..490,497..502,509..511,
                     563..571,575..580,587..592,599..601,608..634)
                     /gene="arm"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <629..>1123
                     /gene="arm"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    662..739
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    758..874
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    893..991
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(962..964,974..976,986..988,1088..1090,1100..1102,
                     1112..1114,1217..1219,1229..1231,1241..1243)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1013..1123
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1139..1246
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1262..1375
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1265..1372
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1409..1486
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1457..1459,1469..1471,1481..1483,1589..1591,
                     1601..1603,1613..1615,1727..1729,1739..1741,1751..1753)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1496..1624
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1508..1624
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1649..1756
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1931..1933,1943..1945,1955..1957,2054..2056,
                     2066..2068,2078..2080,2177..2179,2189..2191,2201..2203)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1970..2089
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1979..2089
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2102..2206
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     polyA_site      3224
                     /gene="arm"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attccacgac ctatcgacta tcgcccatcg ctagttggtc tctgctttgt cgtatacagt
       61 ttttttcgag cgagttcacc gttaatttgt gtcccagtgc gttttaaaca aataaatcct
      121 gctctaaggc agacctagat tacttggacg cggtgtggtg taaagcgcct taatcaccaa
      181 gatgagttac atgccagccc agaatcgtac catgtcgcat aataatcaat acaatccgcc
      241 ggatctcccg ccgatggtgt ccgccaagga gcagaccctc atgtggcagc agaactcgta
      301 tctgggcgac tccggcatcc actcgggggc cgtgacccag gtgccgtcgc tgtccggcaa
      361 ggaggacgag gagatggagg gggatcccct gatgttcgac ctggacaccg ggttcccgca
      421 gaactttacg caggaccagg tggacgacat gaaccagcag ctgagccaga cgcgctccca
      481 acgcgtccgg gctgccatgt tcccggagac gctggaggag ggcatcgaga ttccctccac
      541 ccagttcgat ccccagcagc cgacggcggt gcagcgtctc tcggagccgt cgcagatgct
      601 gaagcacgcg gtggtgaatc tgatcaacta ccaggacgac gccgagctgg ccaccagggc
      661 cattccggag ctgatcaagc tgctgaacga cgaggaccag gtggtcgtct cccaggcggc
      721 catgatggtc caccagctgt ccaagaagga ggcctcgcgc cacgccatca tgaacagccc
      781 ccagatggtg gccgccctgg tgcgcgccat ctccaacagc aacgatctgg agagcaccaa
      841 ggccgcggtg ggcacgctgc acaacttgtc gcaccatcgc cagggcctcc tggccatctt
      901 caagagcggc ggaatcccgg cactcgtcaa gctgctctcc tcgccggtgg agagtgtgct
      961 cttctacgca ataaccacgc tgcacaacct gctgctccac caggacggct ccaagatggc
     1021 cgtacgcctg gccggcggcc tccagaagat ggtcacgctg ctgcagagga acaacgtcaa
     1081 gttcctggcc atcgtcaccg attgcctgca gattctggcc tacggcaacc aggagagcaa
     1141 gctcataatc ctcgcctccg gcgggccgaa cgagctggtg cgcatcatgc gctcctacga
     1201 ctacgagaag ctgctgtgga ccacctcgcg ggtgctcaag gtgctgtccg tctgctccag
     1261 caacaagccg gccatcgtgg acgccggcgg catgcaggcg ctggccatgc acctgggcaa
     1321 catgtcgccg cgcctcgtgc agaactgtct gtggacactg cgcaacctgt ccgacgcggc
     1381 caccaaggtg gagggtctcg aggccctgct ccagtcgctc gtccaggtcc tgggctccac
     1441 cgatgtcaac gtggtcacct gtgccgccgg catcctctcg aatctgacgt gcaacaatca
     1501 gcgcaacaag gccaccgtct gccaggtggg cggcgtggac gccctcgtcc gcaccatcat
     1561 caatgccggg gatcgcgagg agatcaccga gccggccgtt tgcgccctgc gccacctgac
     1621 ctcgcgtcac gtggactcgg agctggccca gaatgccgtg cgtctcaact acgggctgtc
     1681 ggtgattgtg aagctgctgc atccaccgtc ccgctggccg ttgatcaagg ccgtcattgg
     1741 gctcatacgc aacttggccc tctgtccggc caaccacgcc ccgttgcggg agcacggggc
     1801 catccatcac ctggtgcggc tgctaatgcg cgccttccag gacacagaga ggcaacgctc
     1861 ctcgattgcc accacgggct cccagcagcc gtctgcctac gccgacggcg tgcgcatgga
     1921 ggagattgtc gagggcacgg tgggggccct gcatatcctg gcccgtgagt cccacaaccg
     1981 ggcgctcatt cgccagcagt cggtgatacc gatctttgtg cgtttgctgt tcaacgaaat
     2041 cgagaatatt cagcgcgtgg ctgctggggt tctttgtgag ctggccgccg acaaggaggg
     2101 cgccgagatt atcgagcagg agggcgccac cgggccgctg accgacctgc tgcactcgcg
     2161 caacgagggc gtggccacgt acgctgccgc cgtgctcttc cgcatgagcg aggacaagcc
     2221 gcaggactac aagaagcgcc tgtccatcga gctgaccaac tcgctgctgc gcgaggacaa
     2281 caacatttgg gccaacgccg acctgggcat gggtcccgat ctgcaggata tgcttggacc
     2341 agaagaagca tatgaaggcc tgtacggaca aggtccgccc agcgtgcaca gttcgcacgg
     2401 aggtcgcgca ttccatcagc aaggatatga tactctacca atagattcga tgcagggtct
     2461 ggagatcagc agcccggtgg gcggcggcgg cgctggcggt gctgccggca atggtggagc
     2521 ggtgggcgga gctggcggcg gcggcggcaa catcggcccc atcccgccca gcggcgcacc
     2581 cacatcaccc tactccatgg acatggatgt cggcgagatt gatgccggtg cattgaactt
     2641 tgatttggac gccatgccga cgccacccaa tgacaacaac aatctggctg cctggtacga
     2701 caccgactgc tagacgacga tgacgaggag cgagcgaaag agccgagcta agggtaaggg
     2761 tcgaggagca tcaatccatt cgaccccaaa aacgagataa cacaaaacac acgagtcccc
     2821 cgtcccagca atatagccct tttccactag gacgtggaga tgcagatgga gatggagcaa
     2881 tcactgatga ccgatcaccg atataccgat attgactaga tcaacggaga gtgttgattt
     2941 tacttgacaa agacgaggaa ggaagatagg atgctgcggc aggaagagcg agacgaaggc
     3001 aatccgaagg tccgtgtccg tggaagaagg ctattgttca cacacccctc gacaaacata
     3061 cacacccaca cgggcatact ggcatacatg aataatatta tatattaatt ataatgcgaa
     3121 cgcagcggca taaaacatat tatatgatgc attacatatt atccacgtaa acgaaatgga
     3181 aaattaaaca aatgtttgca atagaactcg tacatttccc ttca