Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii armadillo (arm), transcript


LOCUS       XM_017151126            3214 bp    mRNA    linear   INV 09-DEC-2024
            variant X1, mRNA.
ACCESSION   XM_017151126
VERSION     XM_017151126.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151126.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3214
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3214
                     /gene="arm"
                     /note="armadillo; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:108063862"
     CDS             172..2703
                     /gene="arm"
                     /codon_start=1
                     /product="armadillo segment polarity protein isoform X1"
                     /protein_id="XP_017006615.1"
                     /db_xref="GeneID:108063862"
                     /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS
                     GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT
                     LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG
                     GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAAGNGGAVGGAGGGGGNIGPIPPSG
                     APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC"
     misc_feature    424..648
                     /gene="arm"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(442..453,463..468,472..480,487..492,499..501,
                     553..561,565..570,577..582,589..591,598..624)
                     /gene="arm"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <619..>1113
                     /gene="arm"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    652..729
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    748..864
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    883..981
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(952..954,964..966,976..978,1078..1080,1090..1092,
                     1102..1104,1207..1209,1219..1221,1231..1233)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1003..1113
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1129..1236
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1252..1365
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1255..1362
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1399..1476
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1447..1449,1459..1461,1471..1473,1579..1581,
                     1591..1593,1603..1605,1717..1719,1729..1731,1741..1743)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1486..1614
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1498..1614
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1639..1746
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1921..1923,1933..1935,1945..1947,2044..2046,
                     2056..2058,2068..2070,2167..2169,2179..2181,2191..2193)
                     /gene="arm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1960..2079
                     /gene="arm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1969..2079
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2092..2196
                     /gene="arm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     polyA_site      3214
                     /gene="arm"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agggcgatat atgtatacga tattccctat cgctatagcc ctatacacag ttttcgcagt
       61 cggttgttgt cgaattttaa gattcaagtg cgtttaaaca acagaaacct gcctttgagc
      121 agacaaaatt acttctgacg cggtgtggtg taaagcgcct taatcaccaa gatgagttac
      181 atgccagccc agaatcgtac catgtcgcat aataatcaat acaatccgcc ggatctcccg
      241 ccgatggtgt ccgccaagga gcagaccctc atgtggcagc agaactcgta tctgggcgac
      301 tccggcatcc actcgggggc cgtgacccag gtgccgtcgc tgtccggcaa ggaggacgag
      361 gagatggagg gggatcccct gatgttcgac ctggacaccg ggttcccgca gaactttacg
      421 caggaccagg tggacgacat gaaccagcag ctgagccaga cgcgctccca acgcgtccgg
      481 gctgccatgt tcccggagac gctggaggag ggcatcgaga ttccctccac ccagttcgat
      541 ccccagcagc cgacggcggt gcagcgtctc tcggagccgt cgcagatgct gaagcacgcg
      601 gtggtgaatc tgatcaacta ccaggacgac gccgagctgg ccaccagggc cattccggag
      661 ctgatcaagc tgctgaacga cgaggaccag gtggtcgtct cccaggcggc catgatggtc
      721 caccagctgt ccaagaagga ggcctcgcgc cacgccatca tgaacagccc ccagatggtg
      781 gccgccctgg tgcgcgccat ctccaacagc aacgatctgg agagcaccaa ggccgcggtg
      841 ggcacgctgc acaacttgtc gcaccatcgc cagggcctcc tggccatctt caagagcggc
      901 ggaatcccgg cactcgtcaa gctgctctcc tcgccggtgg agagtgtgct cttctacgca
      961 ataaccacgc tgcacaacct gctgctccac caggacggct ccaagatggc cgtacgcctg
     1021 gccggcggcc tccagaagat ggtcacgctg ctgcagagga acaacgtcaa gttcctggcc
     1081 atcgtcaccg attgcctgca gattctggcc tacggcaacc aggagagcaa gctcataatc
     1141 ctcgcctccg gcgggccgaa cgagctggtg cgcatcatgc gctcctacga ctacgagaag
     1201 ctgctgtgga ccacctcgcg ggtgctcaag gtgctgtccg tctgctccag caacaagccg
     1261 gccatcgtgg acgccggcgg catgcaggcg ctggccatgc acctgggcaa catgtcgccg
     1321 cgcctcgtgc agaactgtct gtggacactg cgcaacctgt ccgacgcggc caccaaggtg
     1381 gagggtctcg aggccctgct ccagtcgctc gtccaggtcc tgggctccac cgatgtcaac
     1441 gtggtcacct gtgccgccgg catcctctcg aatctgacgt gcaacaatca gcgcaacaag
     1501 gccaccgtct gccaggtggg cggcgtggac gccctcgtcc gcaccatcat caatgccggg
     1561 gatcgcgagg agatcaccga gccggccgtt tgcgccctgc gccacctgac ctcgcgtcac
     1621 gtggactcgg agctggccca gaatgccgtg cgtctcaact acgggctgtc ggtgattgtg
     1681 aagctgctgc atccaccgtc ccgctggccg ttgatcaagg ccgtcattgg gctcatacgc
     1741 aacttggccc tctgtccggc caaccacgcc ccgttgcggg agcacggggc catccatcac
     1801 ctggtgcggc tgctaatgcg cgccttccag gacacagaga ggcaacgctc ctcgattgcc
     1861 accacgggct cccagcagcc gtctgcctac gccgacggcg tgcgcatgga ggagattgtc
     1921 gagggcacgg tgggggccct gcatatcctg gcccgtgagt cccacaaccg ggcgctcatt
     1981 cgccagcagt cggtgatacc gatctttgtg cgtttgctgt tcaacgaaat cgagaatatt
     2041 cagcgcgtgg ctgctggggt tctttgtgag ctggccgccg acaaggaggg cgccgagatt
     2101 atcgagcagg agggcgccac cgggccgctg accgacctgc tgcactcgcg caacgagggc
     2161 gtggccacgt acgctgccgc cgtgctcttc cgcatgagcg aggacaagcc gcaggactac
     2221 aagaagcgcc tgtccatcga gctgaccaac tcgctgctgc gcgaggacaa caacatttgg
     2281 gccaacgccg acctgggcat gggtcccgat ctgcaggata tgcttggacc agaagaagca
     2341 tatgaaggcc tgtacggaca aggtccgccc agcgtgcaca gttcgcacgg aggtcgcgca
     2401 ttccatcagc aaggatatga tactctacca atagattcga tgcagggtct ggagatcagc
     2461 agcccggtgg gcggcggcgg cgctggcggt gctgccggca atggtggagc ggtgggcgga
     2521 gctggcggcg gcggcggcaa catcggcccc atcccgccca gcggcgcacc cacatcaccc
     2581 tactccatgg acatggatgt cggcgagatt gatgccggtg cattgaactt tgatttggac
     2641 gccatgccga cgccacccaa tgacaacaac aatctggctg cctggtacga caccgactgc
     2701 tagacgacga tgacgaggag cgagcgaaag agccgagcta agggtaaggg tcgaggagca
     2761 tcaatccatt cgaccccaaa aacgagataa cacaaaacac acgagtcccc cgtcccagca
     2821 atatagccct tttccactag gacgtggaga tgcagatgga gatggagcaa tcactgatga
     2881 ccgatcaccg atataccgat attgactaga tcaacggaga gtgttgattt tacttgacaa
     2941 agacgaggaa ggaagatagg atgctgcggc aggaagagcg agacgaaggc aatccgaagg
     3001 tccgtgtccg tggaagaagg ctattgttca cacacccctc gacaaacata cacacccaca
     3061 cgggcatact ggcatacatg aataatatta tatattaatt ataatgcgaa cgcagcggca
     3121 taaaacatat tatatgatgc attacatatt atccacgtaa acgaaatgga aaattaaaca
     3181 aatgtttgca atagaactcg tacatttccc ttca