Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii chymotrypsin-elastase inhibitor


LOCUS       XM_017151116             445 bp    mRNA    linear   INV 09-DEC-2024
            ixodidin (LOC108063855), mRNA.
ACCESSION   XM_017151116
VERSION     XM_017151116.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151116.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..445
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..445
                     /gene="LOC108063855"
                     /note="chymotrypsin-elastase inhibitor ixodidin; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063855"
     CDS             85..369
                     /gene="LOC108063855"
                     /codon_start=1
                     /product="chymotrypsin-elastase inhibitor ixodidin"
                     /protein_id="XP_017006605.1"
                     /db_xref="GeneID:108063855"
                     /translation="MMLFHSNYLLLISCCCLVLTVTAQIPITPRECAENETFLACGPS
                     CQTECATLGKPCLINHIRCPDGCYCNKGFARNSGGRCIPIAKCNKGGYGK"
     misc_feature    178..345
                     /gene="LOC108063855"
                     /note="Trypsin Inhibitor like cysteine rich domain;
                     Region: TIL; pfam01826"
                     /db_xref="CDD:460351"
     misc_feature    order(205..207,217..219,259..261,271..273)
                     /gene="LOC108063855"
                     /note="reactive site [polypeptide binding]; other site"
                     /db_xref="CDD:410995"
     polyA_site      445
                     /gene="LOC108063855"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcatcatcc caagtagtgg gtataaaaac ccggtggcag tgagctcatc ggtttagttt
       61 gctgtggatg ctccacaagt tctcatgatg ttgttccact cgaattattt actgctgatc
      121 agctgctgct gcctggttct tacggtcaca gcgcagattc ccatcacgcc ccgagaatgt
      181 gcggaaaacg agactttcct ggcctgcggt cccagttgcc aaacggaatg tgccacgctg
      241 ggaaaaccct gcctgattaa tcacatccga tgtcccgatg gatgctattg caacaaggga
      301 ttcgccagga attcaggggg ccggtgcatt cccatcgcca agtgcaacaa aggcggttac
      361 ggaaagtaga agcggttatc aagaaataca tggctaatta aaaaccactg aaaacttgaa
      421 gacaataaaa ttcaatggga tgata