Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151116 445 bp mRNA linear INV 09-DEC-2024 ixodidin (LOC108063855), mRNA. ACCESSION XM_017151116 VERSION XM_017151116.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151116.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..445 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..445 /gene="LOC108063855" /note="chymotrypsin-elastase inhibitor ixodidin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063855" CDS 85..369 /gene="LOC108063855" /codon_start=1 /product="chymotrypsin-elastase inhibitor ixodidin" /protein_id="XP_017006605.1" /db_xref="GeneID:108063855" /translation="MMLFHSNYLLLISCCCLVLTVTAQIPITPRECAENETFLACGPS CQTECATLGKPCLINHIRCPDGCYCNKGFARNSGGRCIPIAKCNKGGYGK" misc_feature 178..345 /gene="LOC108063855" /note="Trypsin Inhibitor like cysteine rich domain; Region: TIL; pfam01826" /db_xref="CDD:460351" misc_feature order(205..207,217..219,259..261,271..273) /gene="LOC108063855" /note="reactive site [polypeptide binding]; other site" /db_xref="CDD:410995" polyA_site 445 /gene="LOC108063855" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctcatcatcc caagtagtgg gtataaaaac ccggtggcag tgagctcatc ggtttagttt 61 gctgtggatg ctccacaagt tctcatgatg ttgttccact cgaattattt actgctgatc 121 agctgctgct gcctggttct tacggtcaca gcgcagattc ccatcacgcc ccgagaatgt 181 gcggaaaacg agactttcct ggcctgcggt cccagttgcc aaacggaatg tgccacgctg 241 ggaaaaccct gcctgattaa tcacatccga tgtcccgatg gatgctattg caacaaggga 301 ttcgccagga attcaggggg ccggtgcatt cccatcgcca agtgcaacaa aggcggttac 361 ggaaagtaga agcggttatc aagaaataca tggctaatta aaaaccactg aaaacttgaa 421 gacaataaaa ttcaatggga tgata